Therdtatha et al. SpringerPlus (2016) 5:1060 DOI 10.1186/S40064-016-2693-4
0 SpringerPlus
RESEARCH
Open Access
CrossMark
Characterization of antimicrobial substance from Lactobacillus salivarius KL-D4 and its application as biopreservative for creamy filling
Phatthanaphong Therdtatha1,2, Chanabhorn Tandumrongpong1, Komkhae Pilasombut3, Hiromi Matsusaki4,
Suttipun Keawsompong1,2 and Sunee Nitisinprasert
'Correspondence: fagisnn@ ku.ac.th
1 Specialized Research Unit, Probiotics and Prebiotics for Health, Department of Biotechnology, Faculty of Agro-Industry, Kasetsart University, Bangkok 10900, Thailand
Full list of author information is available at the end of the article
Abstract
Lactobacillus salivarius KL-D4 isolated from duck intestine produced bacteriocin which was stable at high temperature and a wide pH range of 3-10. Its cell free supernatant at pH 5.5 exhibited wide inhibitory spectrum against both G+ and G— bacteria. The highest bacteriocin production was obtained in MRS broth supplemented with 0.5 % (w/v) CaCO3 at 6 h by gentle shaking. PCR walking using specific primers at the conserved region of class-II bacteriocin resulted in 4 known genes of kldl, kld2, kld3 and kld4 with 100 % similarity to genes encoding for salivaricin a, p, induction peptide and histidine protein kinase of Lb. salivarius GJ-24 which did not previously report for bacteriocin characterization, while showing 94, 93, 59 and 62 % to other salivaricin gene cluster, respectively. The high activities of 25,600 AU/ml indicated a strong induction peptide expressed by kld3 which has low similarity to previous inducer reported. Based on operon analysis, only kldl, kld3 and kld4 could be expressed and subsequently elucidated that only salivaricin a like bacteriocin was produced and secreted out of the cells. Using protein purification, only a single peptide band obtained showed that this strain produced one bacteriocin which could be salivaricin a namely salivaricin KLD showing about 4.3 kDa on SDS-PAGE. Partial purification by 20 % ammonium sulfate precipitation of the product was tested on the artificial contamination of creamy filling by Bacillus cereus, Enterococcus faecalis, Pseudomonasstutzeri, Staphylococcus sp. and Stenotrophomonas sp. resulting the growth inhibitory efficiency of 4.45-66.9, 11.5-100, 100, 0-28.1 and 5-100 % respectively. Therefore, salivaricin KLD can be a tentative biopreservative for food industry in the future.
Keywords: Lactobacillus salivarius, Salivaricin, Bakery products, Creamy filling, Biopreservative
Background
Bakery products usually contain basic elements of milk, butter, starch, eggs and sugar that provide the nutrient sources for the good growth of microbial contaminants (Pyler 1988). However, these food products are generally considered to be microbiologically safe due to the high temperature of up to 170 °C used in the baking process. Usually,
Springer Open
© 2016 The Author(s). This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.
baked products do not pose a health risk unless they have cream or custard filling containing egg or a dairy product (Stewart et al. 2003). This filling is the most likely source of a serious food safety hazard due to post-baking microbial contamination. Another risk may arise from climatic conditions facilitating microbial growth, especially in a tropical country like Thailand. Several antimicrobial substances, such as acetic acid, propionic acid, sorbic acid and their salts have been used as food preservatives to extend a product's shelf life (Smith et al. 2004). However, their inhibition efficiencies at the neutral pH of bakery products with creamy filling have been reported as low which corresponded to previous studies proposed that chemical preservatives are only effective in bakery products at pH < 6.5 (Guynot et al. 2005; Rosenquist and Hansen 1998). Schmidt et al. (1969) reported that both potassium sorbate and sodium benzoate at a concentration of 1000 ppm could inhibit the growth of Staphylococcus aureus in synthetic cream pies at 22 and 37 °C and at pH 4.5-5.0 but not at a higher pH of 5.2. In addition, it was found that calcium propionate shows no inhibition against rope-producing spores containing B. subtilis, B. licheniformis and B. pumilus in white bread (Thompson et al. 1998).
Recently, biopreservatives produced by lactic acid bacteria (LAB) have been of interest due to consumer concerns regarding chemical additives in food products. Bacteriocin, one of effective biopreservative compounds, is a ribosomally synthesized peptide that has been investigated and widely applied for food preservative in the bakery industry (Chen and Hoover 2003; Galvez et al. 2007). Enterocin AS-48, which is produced by E. faecalis A-48-32, is able to partially reduce the populations of spoilage and potential endospore-forming bacilli in wheat dough stored at 22 °C at a concentration of 14 AU/g (Viedma et al. 2011). Lactobacillus salivarius, one alternative from bacteriocin producing strains is potential to be the biopreservative for bakery products. This species is usually reported as a probiotic candidate frequently isolated from human, porcine, and avian gastrointestinal tracts (Dob-son et al. 2012). It often produces bacteriocin belonging to class II, which typically exhibits antibacterial activity against spoilage bacteria, as well as food-borne pathogens (Messaoudi et al. 2013). Salivaricin ABP-118, which is produced by Lb. salivarius UCC118, demonstrates a broad-spectrum of antibacterial activity, including the Gram-positive bacteria of Listeria, Staphylococcus, Enterococcus and Bacillus species (Dunne et al. 1999). Salivaricin FK22, which is produced by Lb. salivarius K7, displays inhibitory activity against Grampositive bacteria (Pilasombut et al. 2006). It is also reported that salivaricin CRL1328, which is produced by Lb. salivarius CRL1328, shows bacteriocin activity against potential bacteria causing food-poisoning such as E. faecalis and E. faecium (Ocana et al. 1999).
In our laboratory, Lb. salivarius KL-D4 isolated from duck intestine was preliminarily investigated and found that it was able to produce antimicrobial substance (AMS) against potential foodborne pathogen. Therefore, given such potential efficiency, this study aimed to characterize the AMS produced by the strain KL-D4 and further investigate its application as a biopreservative in creamy filling.
Methods
Bacterial strains and culture conditions
Lactobacillus salivarius KL-D4 was used as an AMS producer strain and cultivated in MRS broth (Difco, USA) at 37 °C. All target bacterial strains and their growth conditions used in this study were listed in Table 1. All strains were maintained at -80 °C
Table 1 List of target bacterial strains and their cultivation conditions
Indicator strain
Temperature (°C)
Lactic acid bacteria Lactococcus lactis subsp. cremorisTISTR1344 Lactobacillus plantarum ATCC14917 Lactobacillus sakei subsp. sakei JCM1157T Lactobacillus sakei TISTR890
Leuconostoc mesenteroides subsp. mesenteroides JCM6124 Leuconostoc mesenteroides subsp. mesenteroides TISTR942 Enterococcus fecalis KUB-E5 Enterococcus fecalis KUB-E7 Other Gram-positive bacteria Bacillus cereus JCM2152 Bacillus coagulans JCM2257 Bacillus coagulans TISTR1447 Brochotrixcampeatris NBRC11547 Listeria innocua ATCC33090 Staphylococcus epidermidis KUB-E6 Staphylococcus hominis KUB-E8 Streptococcus sp. TISTR1030 Gram-negative bacteria Aeromonas hydrophila TISTR1321 Escherichia coli O157:H7 Pseudomonas fluorescens JCM5963 Pseudomonas fluorescens TISTR358 Pseudomonas stutzeri KUB-E1 Salmonella enterica serova Enteritidis DMST17368 Stenotrophomonas sp. KUB-E2
30 30 30 30 30 30 37 37
37 37 37 25 37 37 37 30
30 37 25 25 37 37 37
ATCC American Type Culture Collection, Rockville, Md; DMST Department of Medical Science Thailand, Thailand; JCM Japanese Culture of Microorganism, Wako, Japan; NBRC National Institute of Technology and Evaluation (NITE) Biological Resource Center; TISTRThailand Institute of Scientific and Technological Research; KUB Department of Biotechnology, Kasetsart University, Thailand
in appropriate media containing 20 % (v/v) glycerol (Univar, Australia). Escherichia coli DH5a, which was used as a host for cloning, was grown in Luria-Bertani broth (Sam-brook et al. 2001) supplemented with 100 |g/ml of amplicillin (Amresco, USA) at 37 °C with vigorous agitation for 16-18 h.
Determination of enzyme sensitivity
The sensitivity of the bacteriocin to proteolytic enzymes and other enzymes was performed using a reaction containing 1 ml of cell free supernatant (CFS) and 1 mg/ml of each enzyme for 2 h under the following suitable conditions: trypsin and a-chymotrypsin (Sigma-Aldrich, USA) at 25 °C and pH 8.5; a-amylase (Sigma-Aldrich, USA) at 25 °C and pH 7.0; proteinase K (Sigma-Aldrich, USA) at 37 °C and pH 8.0; actinase E (Kaken Pharmaceutical, Japan) and lipase (Sigma-Aldrich, USA) at 37 °C and pH 7.0; pepsin at 37 °C and pH 3.0 (Nacalai Tesque, Japan). After incubation, all reaction mixtures were heated at 100 °C for 5 min and the residual inhibitory activity was determined against Lb. sakei subsp. sakei JCM 1157T using the spot-on-lawn method.
Determination of growth and bacteriocin production
Bacteriocin productivity and growth determination were adapted from Flynn et al. (2002) and Yamamoto et al. (2003). One percent innoculant of KL-D4 strain was grown in 100 ml of MRS broth under four different conditions: static, static supplemented with 0.5 % (w/v) of CaCO3 (Scharlau, European Union), shaking at 120 rpm and shaking at 120 rpm supplemented with 0.5 % (w/v) of CaCO3. All broth cultures were then incubated at 37 °C for 24 h to determine their effects on cell growth and bacteriocin production. Each sample was withdrawn from its broth culture every 3 h to determine cell concentration, pH, and inhibitory activity. The viable cells were monitored in two replications by a standard plate count technique (Wehr and Frank 2004). The specific growth rate (ц) at the exponential phase was calculated equation below:
_ (Inxt2- Inxti) ^ " (t2 - ti)
where xt1 and xt2 are the viable cell concentration measured within the exponential phase of growth at times t1 and t2, respectively.
For further determination of inhibitory activity, the CFS was prepared by heating at 70 °C for 30 min and tested against Lb. Sakei subsp. sakei JCM1157T by the spot-on-lawn method.
Determination of pH and heat stability
Samples of the CFS of 16 h culture solution were adjusted to pH values of 3.0, 4.0, 5.0, 5.5, 6.0, 7.0, 8.0, 9.0 and 10.0 and incubated at 37 °C for 2 h. All samples were then adjusted to pH 5.5 and determined for their residual activities. To determine heat stability, CFS samples were adjusted to pH 5.5 and heated at 100 °C for 5 and 30 min and at 121 °C for 15 min. The remaining bacteriocin activities were determined against Lb. sakei subsp. sakei JCM 1157T by the spot-on-lawn method.
Determination of inhibitory activity
An inhibitory activity was determined using the spot-on-lawn method according to the modified method of Ennahar et al. (1999). The 1.0 % (w/v) soft agar medium, containing the target strain of approximately 107 CFU/ml was overlaid on the same medium containing 1.5 % (w/v) agar. CFS was adjusted to pH 5.5 with 5 N NaOH solution (Merck, Germany) and heated at 70 °C for 30 min. Ten microliters of the sample was spotted onto the overlaid surface and the plate was incubated at an appropriate temperature for each target strain for 18 h. The activity was defined as the reciprocal of the last serial dilution giving a zone of inhibition and expressed as activity units (AU) per milliliter.
Identification of bacteriocin by polymerase chain reaction (PCR)
Identification of genes related to the production and regulation of bacteriocin from Lb. salivarius KL-D4 strain was performed using the PCR walking technique detailed below. All of the primers used in the experiment were shown in Table 2.
Table 2 List of primers and nucleotide sequences
Primer set Sequence 5'-3' Purpose
SalAa-f1 5'-ATGAAGGAATTTACAGTATTGACAGAATGT-3' To amplify kld1
SalAa-r1 5'-TTATAAACAAGTAAGCGCTCCGCCTACCAT-3'
D4-f1 5'-GCTGGTATTGTAGGCGGAGCAAACTTAGGA-3' To amplify kld2,3,4
0ligo105 5'-CYTCDATNGCRTTRTC-3'*
D4-f1 5'-GCTGGTATTGTAGGCGGAGCAAACTTAGGA-3' To amplify kld5
D4-r1 5'-CTACACAATTAGGATAACGTTTCCCACCGT-3
D4-f2 5'-GATTAAGACATTCAAATCAAGATATTTGTA-3' To confirm kld locus
D4-r2 5'-ATGTAACGACTATAAATACAATATTTTGTT-3'
T7 promoter 5'-TAATACGACTCACTATAGGG-3' Colony PCR for pT7Blue-T vector
U-19mer 5'-GTTTTCCCAGTCACGACGT-3'
M13RV 5'-CAGGAAACAGCTATGAC-3' Colony PCR for pMD20-T vector
M13M4 5'-GTTTTCCCAGTCACGAC-3'
* D = A, G, T; R = A, G; Y = C, T
Polymerase chain reaction
Total DNA of Lb. salivarius KL-D4 was extracted following Sato et al. (2000) and used as a template for the PCR amplification. Firstly, PCR was performed using the forward and reverse primers SalAa-f1 and SalAa-r1, respectively, based on the nucleotide sequence of salivacin K21 (Matsusaki et al. 2006). About 50-200 ng of DNA template was amplified with 0.5 |M of each primer in 50 |l of premix solution (Takara Bio Inc, Japan), containing 1.25 units of Ex Taq HS DNA polymerase, 1x Ex Taq buffer (Mg2+ plus), and 0.2 mM of dNTPs. The PCR conditions were: denaturation at 94 °C for 3 min, followed by 30 cycles including denaturation at 94 °C for 1 min, annealing at 45 °C for 1 min and extension at 72 °C for 2 min. The second PCR followed was performed using an internal sense primer D4-f1 located at the internal sequence of the first PCR product and 0ligo105 related to the consensus sequence of histidine protein kinase (Losteinkit et al. 2001). The reaction of the PCR mixtures (50 |l) consisted of about 50-200 ng of DNA template, 0.5 |M of D4-f1 primer, 1.5 |M of 0ligo105 primer, 1.25 U of Ex Taq HS DNA polymerase, 1x Ex Taq buffer (Mg2+ plus) and 0.2 mM of dNTPs. The PCR conditions were: denaturation at 94 °C for 3 min, followed by 30 cycles included denaturation at 94 °C for 1 min, annealing at 53 °C for 1 min and extension at 72 °C for 3 min. PCR product obtained was analysed by agarose gel electrophoresis and further submitted for cloning and nucleotide sequence analysis.
Inverse PCR
An inverse PCR technique was performed using the DNA template of restriction enzyme digested chromosomal DNA and primers of D4-f1 and the internal antisense primer D4-r1 located on the internal sequence of the first PCR product. The genomic DNA was randomly cut by restriction enzymes, including ApaI, SalI, BanIII, HindIII, £coRI, XbaI, Xhol, SacI and SacII (Takara Bio Inc, Japan). Each enzymatic treatment was performed in 400 |l of premix solution, containing 50 ng of genomic DNA, 10X buffer of each enzyme and 1 unit of the enzyme. All treatments were incubated at 37 °C for 24 h. Subsequently, the digested DNA was purified using a phenol-chloroform treatment and
precipitated using cold ethanol. Self ligation of the digested DNA obtained was performed in 5 |l of Ligation high Ver.2 (Toyobo, Japan) at 16 °C for 2 h. The ligated DNA solution was purified using ethanol precipitation, dried using a Mini Vacuum-Centrifugal Evaporator (Tomy, Japan) and dissolved in 100 |l of TE buffer. To perform the inverse PCR reaction, 10 ng of each ligation product was amplified with 10 |M of each primer in 50 |l of premix solution (Takara Bio Inc, Japan) containing, 10 |M of D4-f1 primer, 10 |M of D4-r1 primer, 1.25 units of PrimeSTAR HS DNA polymerase (TaKaRa, Japan), 5x PrimeSTAR buffer (Mg2+ plus) and 2.5 mM of dNTPs. The amplification program was 94 °C for 3 min, 30 cycles of 98 °C for 10 s, 55 °C for 5 s, 72 °C for 10 min with a final extension at 72 °C for 20 min. PCR product obtained was analysed by agarose gel electrophoresis and further submitted for cloning and nucleotide sequence analysis.
Analysis of gene cluster from Lb. salivarius KL-D4
The gene cluster was performed using the primer D4-f2 and the antisense primer D4-R2 located on the upstream and downstream region of the cluster gene, respectively. The reaction of the PCR mixtures (50 |l) consisted of about 50-200 ng of genomic DNA used as a template, 10 |M of each primer, 1.25 units of PrimeSTAR HS DNA Polymerase, 5X PrimeSTAR buffer (Mg2+ plus) and 2.5 mM of dNTPs. The PCR conditions were: denaturation at 94 °C for 3 min, followed by 30 cycles included denaturation at 98 °C for 10 s, annealing at 55 °C for 15 s and extension at 72 °C for 1.30 min. PCR product obtained was analysed by agarose gel electrophoresis and further submitted for cloning and nucleotide sequence analysis.
Cloning and DNA sequencing
All PCR products obtained were purified using a QIAEX II kit (Qiagen, USA). The amplified PCR products performed by the set of SalAa-f1, SalAa-r1 and D4-f1, 0ligo105 were cloned into pT7Blue-T vector (Novagen, USA) while the rest were cloned into pMD20-T vector (Takara, Japan). All PCR products were ligated using 5 | l of Liga-tion high Ver.2 at 16 °C for 2 h. Ligation products were transformed into E. coli DH5a according to the transformation method of Sambrook et al. (2001). The positive clones were screened using blue-white colony selection on agar plates and the recombinant plasmids were examined for the presence of the genes related to bacteriocin production using the colony PCR technique as follows. Each positive clone was suspended in 10 |l of 2X EmeraldAmp PCR Mastermix (Takara Bio Inc., Japan) and 2 |l of each primer. The PCR conditions were: denaturation at 94 °C for 5 min, 35 cycles included denaturation at 94 °C for 10 s, annealing at 55 °C for 30 s and extension at 72 °C for 2 min. The recombinant plasmid of the positive clone was extracted using a FlexiPrep™ kit (Amersham Biosciences, USA) and sequenced by the modified method of Sanger and Coulson (1975) using a LI-C0R automated DNA sequencer model 4200 (Li-C0R Biosciences, USA).
Data analysis
Database searches were performed using blastx in the BLAST program of the National Center for Biotechnology Information (NCBI; http://www.ncbi.nlm.nih.gov/BLAST). Open reading frame analysis was performed using the ORF finder program (http://www. ncbi.nlm.nih.gov/gorf/gorf.html). Peptide property predictions were performed using a
peptide property calculator program (Innovagen, http://www.pepcalc.com). Nucleotide sequences alignment was performed using the GENETYX-MAC software (GENETYX®, Japan). Promoter prediction was performed using the Neural Network Promoter Prediction software (http://www.fruitfly.org/seq_tools/promoter.html). Protein sequences alignment was performed using the BioEdit Sequence Alignment Editor program V.7.0.0 (http://www.mbio.ncsu.edu/BioEdit/bioedit.html).
Bacteriocin purification Purification method
According to the modified method of Flynn et al. (2002), the bacteriocin was purified by three steps of purification, consisting of an ammonium sulfate precipitation, cation exchange chromatography and reverse-phase HPLC. All fractions collected were determined for bacteriocin activity using Lb. sakei subsp. sakei JCM 1157T as an indicator strain.
Ammonium sulfate precipitation
One liter of CFS from 16 h culture grown in MRS and 0.5 % (w/v) of CaCO3 at 37 °C under shaking conditions at 120 rpm was heated at 70 °C for 30 min and subsequently cooled down to 4 °C. The bacteriocin precipitation was achieved using 20 % (w/v) saturated ammonium sulfate (Univa, Australia) and stirred at 4 °C for 18 h. The bacteriocin pellets were collected by centrifugation at 4400xg for 20 min and dissolved in 1 l of 20 mM citrate buffer pH 5.5 to dilute salt concentration.
Cation exchange chromatography
Cation exchange chromatography was performed using a fast protein liquid chroma-tography (FPLC) system (ÄKTA™ explorer, model 900, Amersham Bioscience, USA) with the Unicorn V.5.01 software. The UV detection used in this step was carried out at 220 nm. One liter of AMS solution from ammonium sulfate precipitation was applied into 20 ml of the strong cation exchange resin (SP Sepharose Fast Flow, Amersham, Sweden) packed in a XK16 column (Amersham Bioscience, USA) at a flow rate of 2 ml/min and washed with 3x column volume of 20 mM citrate buffer pH 5.5 at the flow rate of 1 ml/min. One-step elution of 20 ml buffer containing 0.8 M NaCl was used to obtain the bacteriocin solution.
Reverse-phase HPLC
This process was performed using the Breeze 2 System (Walter, USA), including a binary pump: model 1525 (Walter, USA), a 6 port injector: model 7725 (Rheodyn, USA), a UV/ visible detector: model 2489 (Walter, USA) and a computer with the Breeze software installed. The bacteriocin separation was achieved using a Resource RPC 3 ml column (Amersham Bioscience, Sweden) at the flow rate of 1 ml/min. The injection sample volume was 5 ml. Two mobile phase systems were used and consisted of solvent A (0.1 % (v/v) trifluoroacetic acid (TFA) in deionized water) and solvent B (acetonitrile containing 0.1 % TFA). Five milliliters of bioactive fractions obtained from cation exchange chroma-tography was subjected to the Resource RPC column equilibrated with 3X column volume of solvent A. Elution was then carried out with a linear gradient of 100 %A/0 %B to
0 %A/100 %B for 30 min. The active fractions were subjected to RP-HPLC a second time to obtain the pure bacteriocin. The residual acetonitrile was removed by using a speed vacuum concentrator (Uivapo100H, Uniequip, Germany) before testing the bacteriocin activity and applying it for SDS-PAGE.
Determination of protein concentration
Protein concentrations were determined using a Bio-Rad protein Assay kit (Bio-Rad, USA), which was based on the Bradford method (Kruger 2002).
Tris-Tricine SDS-PAGE
An active fraction was subjected to 15 % (w/v) polyacrylamide-gel electrophoresis as described by Bollage and Edelstein (1991) using a Tris-Tricine buffer system performed according to the manufacturer's instruction of the Mi-Protean® Tetra system (Bio-Rad, USA) at 100 V for 45 min. Fermentas Spectra™ Multicolor Low Range Protein Ladder (Thermo Scientific, USA) was used to estimate the molecular weight of the pure bacteriocin. The gel was stained using a Pierce® Silver stain kit (Thermo Scientific, USA).
Zymogram analysis
A zymogram of bacteriocin was performed as described by Losteinkit et al. (2001). After electrophoresis, the gel was divided into two parts. The first part was stained with the silver stain kit to check the bacteriocin purity. The second part was used to determine the activity against Lb. sakei subsp. sakei JCM1157T by washing three times with sterilized water for 10 min and subsequently placing on MRS agar containing the target strain to obtain a clear zone.
Preparation of bacteriocin-treated bacterial contaminating Filling
To prepare partially purified salivaricin KLD (PP-KLD), 1 L of CFS from 16 h culture grown in MRS and 0.5 % (w/v) of CaC03 at 37 °C under shaking conditions at 120 rpm was heated at 70 °C for 30 min and cooled down to 4 °C. The bacteriocin was precipitated using 20 % saturated ammonium sulfate (Univa, Australia), stirring at 4 °C for 18 h and centrifuging at 4400xg for 20 min. Subsequently, the bacteriocin pellets obtained were dissolved in 20 ml of 20 mM citrate buffer pH 5.5 and later freeze dried (FD50 Series, Epsilon, Thailand). The freeze-drying was performed under a vacuum as follows: pre-freeze at -35 °C for 3 h, main drying at -35, 10 and 25 °C for 2, 6 and 6 h, respectively, and final drying at 35 °C for 13 h. The inhibitory activities of 800,000 AU/g against Lb. sakei subsp. sakei JCM 1157T were obtained.
To prepare creamy filling, 1 g of the filling consisting of evaporated milk (0.30 g), egg (0.10 g), sucrose (0.18 g), corn flour (0.06 g) and butter (0.06 g) was mixed well at 60-70 °C for 10 min and then sterilizing by autoclaving at 121 °C for 15 min. Then, 0.3 ml of PP-KLD to obtain the final concentrations of 1, 5 and 10 % by weight of filling (w/w),
1 % (w/w) of commercial food preservative H-3 (Asama Chemical, Japan) and 2 % (w/w) of glycine (Yuki Gosei Kogyo, Japan) were added and mixed well. The concentration of commercial products used was the maximum that do not effect to the taste of products. Sterilized distilled water was added instead of AMS and used as a negative control.
To perform bacterial contamination, a single colony of each target strain was inoculated in 5 ml of nutrient broth (NB) and incubated at 37 °C for 16 h under shaking conditions at 150 rpm. Subsequently, 10 |l of each target strain was inoculated into the filling and AMS-treated filling to obtain the final cell concentration of 5 log CFU/g and then mixed well using a stomacher (Seward, England) at normal speed for 1 min. All treatments were incubated at 37 °C for 3 days. Total viable counts at 0 and 3 days were determined by the standard plate-count method (Wehr and Frank 2004). Each treatment was performed for two replications. The growth inhibitory efficiency (GIE) in the filling was evaluated according to the modified method of Wongsuttichote and Nitisinprasert (2009) using the equation:
Cc-Ct GIE = —-t x 100
where Cc and Ct are log CFU of the control (without AMS) and the treatment (addition of AMS) at each condition, respectively.
Statistical analysis
The average values from the duplicate experiments were determined using an Excel program (Microsoft Corp., USA). To determine the standard deviations and statistical significance of data, a one-way ANOVA was performed at the 95 % confidence interval (P < 0.05) using the SPSS statistical package version 22 (IBM Corp., USA).
Results
Preliminary identification of antimicrobial substance from Lb. salivarius KL-D4
The inhibitory activity of a KL-D4 strain was completely eliminated when the culture solution was treated with all proteolytic enzymes except amylase and lipase (Table 3). These results strongly indicated that the AMS is a proteinaceous structure corresponding to the bacteriocin definition (Klaenhammer 1993). Therefore, this AMS produced by the KL-D4 strain was a bacteriocin.
Effect of CaCO3 and agitation to cell growth and bacteriocin production
The effects of the CaC03 added to neutralize the lactic acid during growth and low agitation at 120 rpm were determined under four different conditions: shaking at at low velocity of 120 rpm (SK), shaking at 120 rpm supplemented with 0.5 % (w/v) of CaC03 (SK + Ca), static conditions (ST) and static conditions supplemented with 0.5 % (w/v) of CaC03 (ST + Ca). The results were shown in Fig. 1a, b. The growth of all conditions were increased dramatically at log phase and approached the stationary phase since 6 h. Their viable cell concentrations decreased at 15-18 h. The ST + Ca condition showed higher viable cell than the ST condition at stationary phase. While the pH of without calcium carbonate of both conditions (3.81-3.89) decreased more than the one with calcium carbonate (4.37-4.6) consequently affecting higher survival cells of fermentation with calcium carbonate addition due to acid accumulation. However, both static conditions produced the maximum bacteriocin level in the log phase within 6 h (1.28 x 104 AU/ml) and then gradually decreased in the stationary phase after 15 h (Fig. 1a). While shaking conditions with Ca produced higher bacteriocin activities of 2.56 x 104 AU/ml in the
Table 3 Inhibitory activities against Lactobacillus sakei subsp. sakei jcm1157T of cell free supernatant under various conditions
Treatment Activity (AU/ml)
Enzymatic stability Control
Protenase K pH 8.0 Pepsin pH 3.0 Trypsin pH 8.5 a-chymotrypsin pH 8.5 Actinase E pH 7.0 a-amylase pH 7.0 Lipase pH 7.0 Heat stability 100 °C for 5 min, pH 5.5 100 °C for 30 min, pH 5.5 121 °C for 15 min, pH 5.5 pH stability pH 3.0 pH 4.0 pH 5.0 pH 5.5 pH 6.0 pH 7.0 pH 8.0 pH 9.0 pH 10.0
12,800 0 0 0 0 0
12,800 12,800
25,600 25,600 25,600
12,800 12,800 12,800 25,600 25,600 25,600 12,800 12,800 12,800
middle log phase (6 h) (Fig. 1b). However, the specific growth rates of all conditions were not significantly different (P > 0.05) shown in Table 4. Therefore, it was clearly shown that the SK + Ca condition displayed higher bacteriocin activities than the static conditions for twofold even their growth rate were not different.
Effect of pH and heat treatment
The results are shown in Table 3 with stability over a wide pH range of 3.0-10.0 with 100 % stability of 25,600 AU/ml in the pH range of 5.5-7.0. Moreover, the bacteriocin activities of 25,600 AU/ml at 100 °C for 5 and 30 min and by autoclaving at 121 °C for 15 min still remained at 100 %.
Inhibitory spectrum of cell free supernatant and partially purified bacteriocin
The CFS levels adjusted to pH 5.5 were determined for inhibitory activity against 17 bacterial strains of both Gram-positive and Gram-negative bacteria (Table 5). All lactic acid bacteria (LAB) tested were inhibited. The most sensitive strain was Lb. sakei subsp. sakei JCM1157T. However, the bacteriocin could not inhibit the growth of Bacillus coagulans TISTR1447, Brochotrix campeatris NBRC11547, Streptococcus sp. TISTR1030, Aero-monas hydrophila TISTR1321, Stenotrophomonas sp. KUB-E2, Escherichia coli O157:H7 and Salmonella enterica serovar Enteritidis DMST17368.
Time (h)
Fig. 1 Growth and bacteriocin production by Lb. salivarius KL-D4 in MRS broth. Static condition (a); shaking condition with 120 rpm (b); supplementation with CaCo3, solid line; with out CaCo3, dash line; pH during fermentation, (triangle); viable cells determined by standard plate count method, (black circle); black bars and white ones are antibacterial activities from culture grown in MRS supplement with and without CaCO3, respectively
Table 4 Specific growth rate of bacteriocin producing Lb. salivarius KL-D4 grown in MRS medium with and without CaCO3 at 37° C under static and shaking condition
Condition Specific growth rate (ц)
Static condition (ST) 0.09 ± 0.01
Static condition with 0.5 % (w/v) of CaCO3 (ST + Ca) 0.08 ± 0.01
Shaking at 120 rpm (SK) 0.06 ± 0.00
Shaking at 120 rpm with 0.5 % (w/v) of CaCO3 (SK + Ca) 0.04 ± 0.00
Partially purified salivaricin KLD (PP-KLD) using 20 % (w/v) saturated ammonium sulfate precipitation exhibited high activities against Enterococcus faecalis KUB-E5 and E. faecalis KUB-E7, which were isolated from the éclair production process. It was interesting that bacteriocin in the form of CFS and partially purified bacteriocin exhibited
Table 5 Inhibitory activities of cell free supernatant and partial purified salivaricin KLD
against various target strains
Indicator strain Inhibitory activity (AU/ml)
Lactic acid bacteria1
Lactococcus lactis subsp. cremorisTISTR1344 800
Lactobacillus plantarum ATCC14917 200
Lactobacillus sakei subsp. Sakei JCM1157T 25,600
Lactobacillus sakei TISTR 890 100
Leuconostoc mesenteroides subsp. mesenteroides JCM6124 400
Leuconostoc mesenteroides subsp. mesenteroides TISTR942 800 Other Gram-positive bacteria1
Bacillus cereus JCM2152 3200
Bacillus coagulans JCM2257 100
Bacillus coagulans TISTR1447 0
Brochotrixcampeatris NBRC11547 0
Listeria innocua ATCC33090 6400
Streptococcus sp. TISTR1030 0 Gram-negative bacteria1
Aeromonas hydrophila TISTR1321 0
Escherichia coli O157:H7 0
Pseudomonas fluorescens JCM5963 800
Pseudomonas fluorescens TISTR358 800
Salmonella enterica serova Enteritidis DMST17368 0 Bacterial contaminants from Éclair product2
Enterococcus fecalis KUB-E5 12,800
Enterococcus fecalis KUB-E7 12,800
Staphylococcus epidermidis KUB-E6 800
Staphylococcus hominis KUB-E8 3200
Pseudomonas stutzeri KUB-E1 1600
Stenotrophomonas sp. KUB-E2 0
The strain KUB-E1, -E2, -E5, -E6, -E7 and -E8 isolated from éclair production process and deposited in theculture collection of the Specialized Research Unit: Probiotics and Prebiotics for Health, Department of Biotechnology, Kasetsart University, Thailand
ATCC American Type Culture Collection, Rockville, Md; DMST Department of Medical Science Thailand, Thailand; JCM Japanese Culture of Microorganism, Wako, Japan; NBRC National Institute of Technology and Evaluation (NITE) Biological Resource Center; TISTR Thailand Institute of Scientific and Technological Research
a Activities determination of CFS
b Activities determination of KLD
inhibitory activities of 800 and 1600 AU/ml, respectively, against Pseudomonas fluorescens and P. stutzeri which were Gram-negative bacteria as well.
Identification of bacteriocin from Lb. salivarius KL-D4 by polymerase chain reaction
Lactobacillus salivarius, the candidate of the bacteriocin producer strain, was discovered many years ago (Messaoudi et al. 2013). Some of these species could produce a bacteriocin named salivacin or salivaricin (Barrett et al. 2007; Flynn et al. 2002; Matsusaki et al. 2006; Ocana et al. 1999; Pilasombut et al. 2006). In this study, the first reaction of the PCR walking technique was performed using the primers SalAa-f1 and SalAa-r1 resulting in one ORF named kld1 which exhibits 100 % identity to the gene encoding for the uncharacterized bacteriocin a peptide of Lb. salivarius GJ-24 (Accession No. EGM49654.1). However, it displayed 94 % identity to the gene encoding Abp118a of Lb.
salivarius (Accession No. AAM61778.1). The kldl sequence of Lb. salivarius KL-D4 was submitted into GenBank of the NCBI database with Accession No. KT307081 on July 16th, 2015. Its molecular weight of 4.202 and isoelectric focusing point of 9.02 (by a peptide property calculator program) were different to other salivaricins a of 4.0 and 8.58, respectively (Barrett et al. 2007; Cho et al. 2011; Flynn et al. 2002; Matsusaki et al. 2006; Ocana et al. 1999; Pilasombut et al. 2006).
Further walking was done using the primer D4-f1 and 0ligo105 designed from kld1 and the degenerate primer based on histidine kinase of class II bacteriocin (Eijsink et al. 2002; Nissen-Meyer et al. 2010; Oppegrad et al. 2007), respectively, resulting in a 1.8 kb PCR fragment which contained three ORFs named kld2, kld3 and kld4. By blast analysis, the kld2, kld3 and kld4 showed identity of 100, 100 and 99 % to the gene encoding uncharacterized bacteriocin ß peptide (Accession No. EGM49653.1), uncharacterized hypothetical protein (Accession No. EGM49652.1) and Abk transduction sensory histidine protein kinase (Accession No. EGM49651.1) of Lb. salivarius GJ-24 of Lb. salivarius GJ-24, respectively. It seemed that the gene cluster of the strain KL-D4 was similar to the one of GJ-24. However, those kld2, kld3 and kld4 displayed different identities to Abp118ß (Accession No. AAM61779.1), the salivaricin induction peptide (Accession No. ABQ84445.1) and the histidine protein kinase (Accession No. AAM61782.1) for 93, 59 and 62 % of other Lb. salivarius strains, respectively.
To investigate other genes, inverse PCR was performed. Chromosomal DNA of Lb. salivarius KL-D4 was randomly digested by 9 restriction enzymes. Only SacI digested chromosomal DNA was successfully amplified by the primers D4-f1 and D4-r1 resulting in 2.3 kb containing an open reading frame of 294 bp named kld5 and the other pMD-20T vector sequences. The kld5 exhibited 99 % similarity to the gene coding unclarified bacteriocin family from Lb. salivarius GJ-24 (Accession No. EGM49655.1) but not to other salivaricin producing strains.
According to the results above, it could be summarized that Lb. salivarius KL-D4 has two structural bacteriocin genes similar to Abp118 a and ß related to the salivaricin family and another two genes to regulation of class-II bacteriocin. Adjacency to the salivaricin gene cluster and confirmation by the primer D4-f2 and the antisense primer D4-r2 are shown in Fig. 2. Two promoter and ribosomal binding sites (RBS) located on the upstream region of kld1 and kld3 were found. An open reading frame (ORF) analysis performed using an ORF Finder program confirmed that two structural genes of kld1 and kld2 were located on different ORF frames of +1 and +3, respectively. It seemed that kld2 did not have its own promoter and RBS for gene expression. It was, therefore, proposed that bacteriocin was expressed by only kld1.
Purification of bacteriocin produced by Lb. salivarius KL-D4
Purification of bacteriocin was achieved by three purification steps as shown in Table 6. Partial purification by 20 % ammonium sulfate saturation and cation exchange chro-matography provided only 1 % yield. The pure bacteriocin was eluted from the reverse phase HPLC with 74 % solvent B (Fig. 3) to obtain purification and yields of 40.68 folds and 0.01 %, respectively. By Tris-Tricine SDS-PAGE analysis, only a single protein band of about 4.3 kDa was obtained as shown in Fig. 4, namely salivaricin KLD.
GATTAAGACATTCAAATCAAGATATTTGTAGCTAAATTGTTTAGCAACTTAACATAACCAGATAGGCACAAAATAATACATCTTACGCTA 100 110 120 130 140 150 160 170 180
AAATGGTGTTTGAATCCGAAATGATAATACAATAAAAGTGTAAGATATGTTTTATAAGTATTTTAGAAAGGATGTGTTTTATGTGTTAAA
MFYKYFRKDVFYVLK
Unclarified bacteriocin family protein (JcldS)
190 200 210 220 230 240 250 260 270
AAAGTTATGGAATATTTGGTTGAATGGCGGATTTATTAGAGGAAATAAGAGATATGTAATATTTCCAATTATTATGGCAATAGGTCTTCC KLWNIWLNGGFIRGNKRYVIFPIIMAIGLP 280 290 300 310 320 330 340 350 360
TCTATCAATGTGGCTATCCGATAACGAAGGAATGTCTTATTTAGAGTATATCCAAGAGCCTAAATGGATAATGTTTG.CTGTTTTTTGTTT LSMWLSDNEGMSYLEYIQEPKWIMFAVFCL
GGTAAGTGGCAGTACACTACTTTATCTATTGGATACTGCAATAAAAGTAAATAAACATATG.
:AAf\GGAfi
GATTATCATGAATAAAGAATTT
К К H M К
1 Alpha peptide (Jildl)
ACAGTATTAACAGAAGTAGAATTAGTTT^GGTAGACGGTGGGAAACGTTATCCTAATTGTGTAGGTAACTTCTTAGGCGGTCTATTTGCT TVLTEVELVKVDGGKRYPNCVGNFLGGLFA 550 560 570 580 590 600 610 620 630
GGAGCAGCTGCAGGAGTTCCACTTGGACCAGCTGGTATTGTAGGCGGAGCAAACTTAGGAATGGTAGGCGGAGCTCTTACTTGTTTATAA GAAAGVPLGPAGIVGGANLGMVGGALTCL* 640 650 660 670 680 690 700 710 720
TAACGGGGTGATTTAAAATGAAAAATCTAGATAAGAGATTTACAATTATGACTGAAGATAATTTATCATCAACAAATGGTGGTAAAAATG
— Beta peptide (Alrf2)
730 740 750 760 770 780 790 800 810
GATATGGTGGAAGTGGAAATCGTTGGGTTCACTGCGGAGCAGGTATCGCAGGTGGAGCTTTGATTGGAGCTATTGGCGGACCGTGGTCAG
G A 850
I A G 8 60
G G P 890
CTCTAGCAGGTGGCATTTCTGGTGGTTTTGCAAGTTGTCGTTAAGATGAGTTTAGTAGGTTAGAAAATaAATCCATTTTTTTCAAATAGT ALAGGISGGFASCR*
910 920 930 940 950 960 970 980 990
GTCAAGTATAAGTTATAGCAAATAACTAATTTGACACTATTTTTTATATATAGGTTCTCGATTTCAGTTTTCAATTAAAATTGAACCAAA
-10 1060
TAAGCATCAAATAAGACCAAATATGATAAAAAATGTATAAAATAAATTAAAAAATGTTAAACTATACATGTAATTAAGTAATA^AGGAjSA
1090 1100 1110 1120 1130 1140 1150 1160 1170
GATTTTTTATGAAGTTTGAAGTTTTAACAGAAAAGAAGTTGCAAGTTGTTGTTGGTGGTAAACAAGAGGGAGGAGGAAGAATTTTTAATT
-» Induction peptide (Aid3)
1180 1190 1200 1210 1220 1230 1240 1250 1260
CTAAATGTATATTTAAATTTTTAGGAACTTGCAAGTAAAATGTCGAACATAGCAGATATATATGATAAATATAATGATATAATATACATT SKCIFKFLGTCK* MSNIADIYDKYNDIIYI
AbpK transduction histidine protein kinase (Jcldi)
1270 1280 1290 1300 1310 1320 1330 1340 1350
TTAGGTTTATTAATTGATATAATATGTGATTATCTATTTTTCTATCTAATTACGCCTATCAATAGAAGTAAGAAACAAAATATTGTATTT LGLLIDIICDYLFFYLITPINRSKKQWIVF 1360 1370 1380 1390 1400 1410 1420 1430 1440
ATAGTCGTTACATTTCCAATAATTTTTTTATACGGTGGAGGTGGAGAGCTAGGTGTTCTTATTTCTGAATTTTTTCAAGTATTAACTTTT
V V T 1450
FLY 1470
G G G 1480
V L I 150 0
S E F 1510
Q V 1520
S S Q 1990
К L 2000
N M 2030
L S L 2040
I S К
L И R
F Q 2210
TATATAGTATATAAAAGGAAGAAAA7\AGATTATCAAGTATTAGGAAGGTTATTAATTCTAGTTCTGTATTCATATCTTTTTTTTGAAATA YIVYKRKKKDYQVLGRLLI LVLYSYLFFEI 1540 1550 1560 1570 1580 1590 1600 1610 1620
GAAACCATATTTTCACTGATAATTGTACCTTATATTAGAGTATCTTCGTTAGGTATAATTTTTATAAATATTTTAGAATATTATATTCTA ETIFSLIIVPYIRVSSLGIIFINILEYYIL 1630 1640 1650 1660 1670 1660 1690 1700 1710
ACTAAAACAAATATTGTAAAGAATCTTGACGAAGAATATGGAAAGACATATTTTTTTCTAATAATTTATTTATTAACTAGTTTTGCCGGA TKTNIVKNLDEEYGKTYFFLIIYLLTSFAG 1720 1730 1740 1750 1760 1770 1780 1790 1800
ATATATTATTTGACTAGCTATTTATTTAAAGTTGATAAGGTATTATATCTTATATTATTAGTAGTTATTGCCTTACAATTAATTTTTTCA IYYLTSYLFKVDKVLYLILLVVIALQLIFS 1810 1820 1830 1840 1850 1860 1870 1880 1890
TTATATATCTATAATAGTAGTAAAAAAATTAGACAAGATAAATTAAATATCCAGCAAATTAAAGATTTAAAGATTTATACGCAACAGTTG LYXYWSSKKIRQDKLWIQQIKDLKIYTQQL 1900 1910 1920 1930 1940 1950 1960 1970 1980
GAAAGTAGTCAACGAAAATTGCGTAAATTCAAGCATGACTATCAAAATATGTTGTTAAGTTTAAGTATTAGTGCTAAAAAGAATCATGAT
К К W H
2 07 0
AAAGAATTAGTAGATAAATTAGCTGAATATTCTAATAAAACTTTAGAAGATAAAGTGTTGTGGCAGTTTAATGATATTGACAATATTAAA KELVDKLAEYSNKTLEDKVLWQFNDIDNIK 2080 2090 2100 2110 2120 2130 2140 2150 2160
GATGATTTACTAAAGAGCTTGTTAATTAGTAAATTAAATAGAATTTTTCAAGATAATATTCAGTACACTTTTGAATGTCGGAACATAATA
GAAAAACTATCCGATGAATATGATTCGTTTGATATTATTAGGATGTTGGGAATAGCGTATGATAATGCGATCGAGG
Fig. 2 Nucleotide sequence and deduced protein in the kld locus. The putative promoter sequences are underlined; the ribosomal binding sites (RBS) are boxed and underlined. Nucleotide sequences alignment was performed using the GENETYX-MAC software (GENETYX®, Japan) on September 28th, 2012. Bacterial promoter prediction was performed using BROM on the Softberry (online program) on August 4th, 2015
Table 6 Purification table of salivaricin KLD
Purification stage Vol. (ml) Activity (AU/ml) Protein concentration (mg/ml) Total protein (mg) Total activity (AU) Specific activity (AU/mg) Purification (folds) Yield (%)
Cell free 1000 25,600 18.600 18,600.000 2.56 x 107 1.38 x 103 1 100
supernatant
(NH4)2SO4 20 102,400 2.150 43.000 2.05 x 106 4.77 x 104 34.57 8.01
precipitate
Cation exchange 20 12,800 0.224 4.480 2.56 x 105 5.71 x 104 41.38 1.00
RP-HPLC 1 3200 0.057 0.057 3.20 x 103 5.61 x 104 40.68 0.01
All % yield values are expressed in terms of activity units in the cell free supernatant taken as 100 % while purification values are in the terms of specific activities in the cell free supernatant taken as 1
Retention time (min)
Fig. 3 Reverse-phase chromatogram of the salivaricin KLD. The target fraction (a salivaricin KLD fraction) was earned by eluting with 74 % of solvent B. Dash line is a gradient condition of solvent B (acetonitrile, %v/v)
Effect of salivaricin KLD on the growth of bacterial contaminants in creamy filling
The partially purified salivaricin KLD using ammonium sulfate precipitation and freeze-drying that exhibited inhibitory activity against bacterial contaminants from the production process of éclair was studied. Six target strains isolated from the production process of E'clair product were used to perform the experiments and the results are summarized in Table 7. The growth inhibitory efficiency (GIE) of 1, 5 and 10 % of KLD compared to the efficiency of two commercial bacteriocins, 1 % H3 and 2 % glycine, were tested at 0 and 3 days as shown in Table 7. Various concentrations of KLD showed high GIE values of 22-39 and 52-100 % against E. faecalis KUB-E5 at 0 and 72 h, respectively, while both the commercial ones displayed only 0.39-1.8 %. The activity of KLD against E. faecalis KUB-E7 was lower than against E. faecalis KUB-E5; however, its activity against E. faeca-lis KUB-E7 was still higher than for the other commercial compounds.
15.0 * 10.0 4.6 *
Fig. 4 Characterization of purified salivaricin KLD. Silver stained Tris-Tricine SDS-PAGE containing 15.0 % Polyacrylamide gel (a), Protein with antibacterial activity visualized by overlaying soft MRS agar containing cells of Lb. sakei subsp. sakei JCM 1157T (b); lane 1 Spectra Multicolor Low Range Protein Ladder (Thermo Scientific Pierce, USA); lane 2: purified salivaricin KLD. The arrows indicate a salivaricin KLD fraction and its activity
Two species of Staphylococcus (S. epidermidis KUB-E6 and S. hominis KUB-E8) were investigated. The 5 and 10 % concentrations of KLD and the 2 % glycine treatment exhibited significantly higher GIE than the other treatments against the growth of only strain KUB-E8, while the KLD showed no activity to the strain KUB-E6 at 72 h.
Bacillus cereus is a frequent contaminant in bakery products and causes rope spoilage. It was found that B. cereus JCM 2152 had significantly (P < 0.05) the highest sensitivity to 10 % KLD resulting in GIE values of 10.14 ± 0.29 and 66.94 ± 0.88 % at 0 and 72 h, respectively, while the activities of 5 % KLD and 1 % H3 showed no significant difference of GIE at 72 h.
Considering the two Gram-negative bacterial strains of Pseudomonas stutzeri KUB-E1 and Stenotrophomonas sp. KUB-E2, P. stutzeri KUB-E1 was more sensitive to 5 and 10 % of KLD at both 0 and 72 h while 1 % KLD exhibited 100 % GIE at 72 h. Both 5 and 10 % KLD also showed 100 % GIE against Stenotrophomonas sp. KUB-E2 at 72 h. Both commercial AMS products (H3 and glycine) had lower GIE levels against both Gramnegative bacteria compared to the KLD.
Discussion
A salivaricin KLD produced by Lb. salivarius KL-D4 showed high resistance to heat, high stability over a wide pH range of 3.0-10.0, and a wide antibacterial spectrum against Gram-positive and Gram-negative bacteria. In addition, it should be noted that the salivaricin KLD is stable at high pH of 8-10, while nisin, a well-known bac-teriocin usually used in the bakery products rapidly loses its activity at a pH of more than 4 (Rollema et al. 1995). The salivaricin KLD also effectively inhibited spore-forming B. cereus, which often contaminates bakery products, such as custards and cream cakes (Siriken et al. 2009). Therefore, these characteristics are promising for applications of the
Table 7 Growth inhibitory efficiency of antimicrobial substances against bacterial contaminants in sterilized creamy filling containing about 5 log CFU/g of each target strain and various food preservatives of PP-KLD, H-3 and glycine
Target strain Treatment Growth inhibitory efficiency (%)b
% (w/w)a 0 h 72 h
Enterococcus fecalis KUB-E5 1 %PP-KLD 22.76 ± 0.82b 52.27 ± 2.09b
5 %PP-KLD 39.30 ± 3.08c 100.00 ± 0.00c
10 %PP-KLD 26.46 ± 0.40b 100.00 ± 0.00c
1 %H-3 0.39 ± 0.16a 1.75 ± 0.27a
2 %Glycine 1.27 ± 0.32a 1.87 ± 0.45a
Enterococcus fecalis KUB-E7 1 %PP-KLD 15.40 ± 3.14b 11.51 ± 5.34b
5 %PP-KLD 17.83 ± 2.43b 30.69 ± 0.28c
10 %PP-KLD 19.96 ± 0.94b 60.12 ± 0.4d
1 %PP-H-3 1.88 ± 0.08a 0.90 ± 0.13a
2 %PP-Glycine 3.61 ± 0.39a 3.89 ± 0.15a
Staphylococcus epidermidis KUB-E6 1 %KLD 1.83 ± 1.02b 0.00 ± 0.00a
5 %KLD 0.46 ± 2.36a 0.00 ± 0.00a
10 %KLD 1.80 ± 2.55b 0.00 ± 0.00a
1 %H-3 3.24 ± 0.38c 24.58 ± 1.11b
2 %Glycine 0.00 ± 0.00a 22.37 ± 1.14b
Staphylococcus hominis KUB-E8 1 %PP-KLD 1.96 ± 1.95a 22.91 ± 0.23a
5 %PP-KLD 3.85 ± 2.66a 28.10 ± 1.38c
10 %PP-KLD 3.37 ± 0.17a 25.80 ± 1.85c
1 %H-3 2.58 ± 0.18a 23.05 ± 0.28ab
2 %Glycine 10.54 ± 0.27b 25.69 ± 0.28bc
Bacillus cereus JCM2152 1 %PP-KLD 2.02 ± 1.43a 4.47 ± 2.43a
5 %PP-KLD 6.18 ± 0.41b 50.39 ± 1.58b
10 %PP-KLD 10.14 ± 0.29c 66.94 ± 0.88c
1 %H-3 3.28 ± 0.19a 44.29 ± 0.29b
2 %Glycine 8.85 ± 0.22c 6.97 ± 0.17a
Pseudomonas stutzeri KUB-E1 1 %PP-KLD 3.92 ± 5.93a 100.00 ± 0.00c
5 %PP-KLD 100.00 ± 0.00c 100.00 ± 0.00c
10 %PP-KLD 100.00 ± 0.00c 100.00 ± 0.00c
1 %H-3 11.35 ± 1.15b 12.53 ± 0.58a
2 %Glycine 14.96 ± 0.31b 64.07 ± 2.34b
Stenotrophomonas sp. KUB-E2 1 %PP-KLD 0.27 ± 0.16a 5.25 ± 2.56a
5 %PP-KLD 0.00 ± 0.00a 100.00 ± 0.00d
10 %PP-KLD 1.50 ± 0.40b 100.00 ± 0.00d
1 %H-3 5.82 ± 0.05c 9.04 ± 0.36b
2 %Glycine 6.24 ± 0.54c 44.84 ± 1.44c
All growth efficiency obtained are a mean of two replications ± SD (SD); a-d, means in the same column of each target strain with different lower case letters are significantly different (P < 0.05)
a Five treatments of antimicrobial substance PP-KLD at the concentrations of 1, 5 and 10 %, 1 % H3 and 2 % glycine tested b Growth inhibitory efficiency defined as percentage of survival cells after antimicrobial substance treatment compared to the control mentioned elsewhere
salivaricin KLD in the creamy production process, as well as in the other bakery lines, which involve alkaline or non acid products.
The salivaricin KLD production was enhanced by culture broth supplemented with 0.5 % (w/v) CaCO3 under gentle shaking. The maximum production was observed in the early stationary phase and was maintained until later stages. Its production was
growth-associated and displayed as primary metabolite kinetic which was similar to almost all bacteriocins produced by lactic acid bacteria (Cheigh et al. 2002; Zamfir et al. 2000). Neutralization of lactic acid in the culture by CaCO3 described by Matsusaki et al. (1996) and increasing the CaCO3 diffusion by gentle shaking could enhance its growth and bacteriocin production as supported by Yamamoto et al. (2003). However, the antibacterial activities observed subsequently decreased in the later stages perhaps due to extracellular proteases produced and acidity during fermentation (Parente and Ricciardi 1999). Bioactivity is usually limited to a narrow time interval of maximum fermentation (about 10-12 h), due to low pH conditions from the accumulation of lactic acid contents or an exhausted energy source. Then, cell growth and the bacteriocin production will gradually stop. Therefore, both the pH value and lactic acid production influenced both the cell growth and the bacteriocin-production kinetics, which must be controlled. The genes responsible for the salivaricin KLD production were located on the 2.3 kb DNA fragment. The cluster of putative genes required for the salivaricin KLD production was similar to other class-IIb bacteriocin gene clusters (Nes et al. 1996). The gene kld1 and kld2 encoding for pre-peptides salivaricin a and ß from Lb. salivarius KL-D4 showed high similarity to the ones from Lb. salivarius GJ-24 isolated from the feces of healthy adults without the characteristics of those peptides reported (Cho et al. 2011). To date, several salivaricins with high structural similarity produced by Lb. salivarius have been isolated from the intestinal tracts of humans and animals, such as salivaricin ABP-118 produced by the strain UCC118 isolated from human intestines (Flynn et al. 2002), salivaricin CRL1328 produced by the strain CRL1328 isolated from healthy human vaginal samples (Ocana et al. 1999), salivaricin P produced by the strain DPC6005 isolated from a porcine intestine (Barrett et al. 2007), salivaricin FK22 and salivacin K21 produced by the strain K7 (Pilasombut et al. 2006) and KUB-AC21 isolated from chicken intestines (Matsusaki et al. 2006). Modification of their amino acid sequences occurred depending on the environment of each source and resulted in only 94 % identity to salivaricin KLD which led to different inhibitoty activity against the growth of the Gram-negative bacteria, Pseudomonas and Stenotrophomonas. To date, no salivaricin from other producer strains have been reported regarding their activity against Gram-negative bacteria.
The genes encoding the KLD3 and KLD4 found were located on the DNA fragment and were involved in bacteriocin production called a three-component regulatory system, that includes peptide pheromone (induction peptide, IF) and histidine protein kinase (HPK) (Diep et al. 2003; Eijsink et al. 2002; Kleerebezem and Quadri 2001). However, kld3 showed only low identity to the peptide pheromone reported, while it induced higher bacteriocin production of up to 25,600 AU/ml compared to the other Lb. salivarius strain reported. This supported a strong induction peptide coded by kld3. However, other genes related with immunity were not observed by this study. Salivaricin KLD was previously tested for its inhibitory activity against its own producer strain resulting in no inhibition. Therefore, the gene encoding IM of the KL-D4 strain may exist but be located elsewhere on chromosomal DNA, which is different to salivaricin APB-118 (Flynn et al. 2002), salivaricin P (Barrett et al. 2007), salivaricin CRL1328 (Vera Pingitore et al. 2009), and salivacin K21 (Matsusaki et al. 2006) which are located near the structural saliva-ricin peptide gene.
Only salivaricin KLD similar to a peptide was expressed and produced by Lb. salivarius KL-D4. This result was similar to Messaoudi et al. (2013) and Flynn et al. (2002) who reported the detection of a peptide in their purification process, while ß peptide could be produced by Lb. salivarius K7 (Pilasombut et al. 2006). However, both a and ß peptides were produced by Lb. salivarius DPC6005 and successfully purified by RP-HPLC (Barrett et al. 2007).
The salivaricin KLD showed high stability within the pH range 5.5-7.0. These properties would make it useful as a biopreservative in low acid food such as bakery products classified as non-acidic (Smith et al. 2004). In a tropical country like Thailand, the contaminant cell concentration can be as high as up to 5 log CFU/g in cream-filled products which differs from the European zone where lower numbers of 1-4 log CFU/g have been reported (Leitenberger and Rocken 1998; Siriken et al. 2009). PP-KLD showed remarkable effective inhibition to contaminant strains of B. cereus, E. fecalis, P. stutzeri, as well as Stenotrophomonas sp. Furthermore, the effective inhibition was superior to the commercial bacteriocins of H-3 and glycine. However, both PP-KLD and the commercial bacteriocins were not active against Staphylococcus species. This might have been negatively influenced by the high incubation temperatures promoting faster growth of Staphylococcus (Viedma et al. 2009), which corresponded with the antimicrobial substance PP-174 produced by Lb. plantarum KJ-174 showing low inhibitory efficiency in cream filling against aerobic mesophilic bacteria, when the incubation temperature was increased from 15 to 37 °C (Wongsuttichote and Nitisinprasert 2009). To solve this problem, combined preservation called hurdle technology (Cleveland et al. 2001) will be needed to achieve successful preservation in future work.
Conclusion
Salivaricin KLD shares functional properties of the bacteriocin a peptide that is heat tolerant, stable at a wide pH range, and exhibited widely antibacterial spectrum. Partial purification by 20 % ammonium sulfate precipitation of the product named PP-KLD was tested on the artificial contamination of creamy filling. The 5 % PP-KLD (w/w) exhibited effective growth inhibitory efficiency against Pseudomonas sp., P. stutzeri, Stenotropho-monas sp. and some strain of E. faecalis but showed low activities against B. cereus, Staphylococcus epidermidis and Staphylococcus hominis. To complete inhibitory activity against microbial contaminants, cooperation with other hurdle technology may be considered in the future.
Authors' contributions
PT, to perform a part of experiments and manuscript preparation; CT, to perform a part of experiments; KP, involve in experimental discussion; HM, involve in experimental discussion; SK, involve in experimental discussion and SN, involve in experimental design and discussion as well as manuscript preparation. All authors read and approved the final manuscript.
Author details
1 Specialized Research Unit, Probiotics and Prebiotics for Health, Department of Biotechnology, Faculty of Agro-Industry, Kasetsart University, Bangkok 10900, Thailand. 2 Center for Advanced Studies for Agriculture and Food (CASAF), Kasetsart University Institute for Advanced Studies (NRU-KU), Kasetsart University, Bangkok 10900, Thailand. 3 Division of Animal Production Technology, Faculty of Agricultural Technology, King Mongkut's Institute ofTechnology Ladkrabang, Bangkok 10520, Thailand. 4 Department of Food and Health Sciences, Faculty of Environmental and Symbiotic Sciences, Prefectural University of Kumamoto, Kumamoto 862-8502, Japan.
Acknowledgements
We express our gratitude to the Center for Advanced Studies for Agriculture and Food, Institute for Advanced Studies, Kasetsart University, under the Higher Education Research Promotion and the National Research University Project of
Thailand, Office of the Higher Education Commission, Ministry of Education, Thailand. Our thanks also go to the Division of Animal Production Technology, Faculty of Agricultural Technology, King Mongkut's Institute of Technology Ladkra-bang, Bangkok, Thailand the Department of Food and Health Sciences, Faculty of Environmental and Symbiotic Sciences, Prefectural University of Kumamoto, Kumamoto, Japan and the Core-to-Core Program supported by Japan Society for the Promotion of Science (JSPS), National Research Council of Thailand (NRCT), Vietnam Ministry of Science and Technology (MOST), the National University of Laos, Beuth University of Applied Sciences and Brawijaya University.
Competing interests
The authors declare that they have no competing interests. Funding
This study was funded by the Center for Advanced Studies for Agriculture and Food, Institute for Advanced Studies, Kasetsart University, under the Higher Education Research Promotion and the National Research University Project of Thailand, Office of the Higher Education Commission, Ministry of Education, Thailand.
Informed consent
An informed consent was obtained from all individual participants included in the study.
Received: 8 December 2015 Accepted: 28 June 2016 Published online: 12 July 2016
References
Barrett E, Hayes M, O'Connor P, Gardiner G, Fitzgerald GF, Stanton C, Ross RP, Hill C (2007) Salivaricin P, one of a family of two-component antilisterial bacteriocins produced by intestinal isolated of Lactobacillus salivarius. Appl Environ Microbiol 73:2719-2723
Bollage DM, Edelstein SJ (1991) SDS-polyacrylamide gel electrophoresis (Linear Slab Gel). Protein methods. Wiley-Liss Inc., New York, pp 96-127
Cheigh CI, Choi HJ, Park H, Kim SH, Kook MC, Kim TS, Hwang JK, Pyun YR (2002) Influence of growth conditions on the production of a nisin-like bacteriocin by Lactococcus lactis subsp. lactis A164 isolated from Kimchi. J Biotechnol 95:225-235
Chen H, Hoover DG (2003) Bacteriocins and their food applications (2). Comprehensive reviews in food science and food
safety. Institute of Food Technologists, Chicago, pp 82-100 Cho YJ, Choi JK, Kim JH, Lim YS, Ham JS, Kang DK, Chun J, Paik HD, Kim GB (2011) Genome sequence of Lactobacillus
salivarius GJ-24, a probiotic strain isolated from healthy adult intestine. J Bacteriol 2011:5021-5022 Cleveland J, Montville TJ, Nes IF, Chikindas ML (2001) Bacteriocins: safe, natural antimicrobials for food preservation. Int Food Microbiol 71:1-20
Diep DB, Myhre R, Johnsborg O, Aakra A, Nes IF (2003) Inducible bacteriocin production in Lactobacillus is regulated by differential expression of the pln operons and by two antagonizing response regulators, the activity of which is enhanced upon phosphorylation. Mol Microbiol 47:483-494 Dobson A, Cotter P, Ross P, Hill C (2012) Bacteriocin production: a probiotic trait? Appl Environ Microbiol 78:1-6 Dunne C, Murphy L, Flynn S, O'Mahony L, O'Halloran S, Feeney M, Morrissey D, Thornton G, Fitzgerald G, Daly C, Kiely B, Quigley EMM, O'Sullivan GC, Shanahan F, Collins JK (1999) Probiotics: from myth to reality. Demonstration of functionality in animal models of disease and in human clinical trial. Antonie Van Leeuwenhoek 76:279-292 Eijsink VGH, Axelsson L, Diep DB, Havarstein LS, Holo H, Nes IF (2002) Production of class II bacteriocins by LAB; an example of biological warfare and communication. Antonie Van Leeuwenhoek 81:639-654 Ennahar S, Zendo T, Sonomoto K, Ishizaki A (1999) Investigation of bacteriocin production and purification from Nuka-
doko isolates displaying antimicrobial activity. Jpn J Lactic Acid Bact 10:29-36 Flynn S, van Sinderen D, Thornton GM, Holo H, Nes IF, Collins JK (2002) Characterization of the genetic locus responsible for the production of ABP-118, a novel bacteriocin produced by the probiotic bacterium Lactobacillus salivarius subsp. salivarius UCC118. Microbiology 148:973-984 Galvez A, Abriouel H, Lopez RL, Ben-omar N (2007) Bacteriocin-based strategies for food biopreservation. Int Food Microbiol 120:51-70
Guynot ME, Ramos AJ, Sanchis V, Marin S (2005) Study of benzoate, propionate, and sorbate salts as mould spoilage
inhibitions on intermediate moisture bakery products of low pH (4.5-5.5). J Food Microbiol 101:161-168 Klaenhammer TR (1993) Genetics of bacteriocins produced by lactic acid bacteria. FEMS Microbiol 12:39-85 Kleerebezem M, Quadri LE (2001) Peptide pheromone-dependent regulation of antimicrobial peptide production in
Gram-positive bacteria: a case of multicellular behavior. Peptides 22:1579-1596 Kruger NJ (2002) The Bradford method of protein quantification. In: Walker JW (ed) The protein protocols handbook, 2nd
edn. Humana Press Inc., Totowa, pp 15-21 Leitenberger E, Rocken W (1998) HACCP in small bakeries. Food Control 9(2-3):151-155
Losteinkit C, Uchiyama K, Ochi S, Takaoka T, Nagahisa K, Shioya S (2001) Characterization of bacteriocin N15 produced by
Enterococcus faecium N15 and cloning of the related genes. J Biosci Bioeng 91(4):390-395 Matsusaki H, Endo K, Sonomoto K, Ishizaki A (1996) Lantibiotic nisin Z fermentative production by Lactococcus lactis IO-1:
relationship between production of lantibiotic and lactate and cell growth. Appl Microbiol Biotechnol 45:36-40 Matsusaki H, Sonomura N, Nitisinprasert S, Zendo T, Sonomoto K (2006) Biosynthesis of salivacin K21, a two- peptide bacteriocin produced by Lactobacillus salivarius AC21 isolated from the chicken intestine in Thailand, pp. 106. The 5th JSPS-NRCT joint seminar on development of thermotolerant microbial resources and their applications. November 7-10, 2006. Pattaya, Thailand
Messaoudi S, Manai M, Kergourlay G, Prevost H, Connil N, Chobert JM, Dousset X (2013) Lactobacillussalivarius: bacteri-
ocin and probiotic activity. Food Microbiol 36:296-304 Nes IF, Diep DB, Havarstein LS, Brurberg MB, Eijsink V, Holo H (1996) Biosynthesis of bacteriocins in lactic acid bacteria.
Antonie Van Leeuwenhoek 70:113-128 Nissen-Meyer J, Oppegrad C, Rogne P, Haugen HS, Kristiansen PE (2010) Structure and mode-of-action of the two-pep-
tide (Class-IIb) bacteriocin. Probiotics Antimicrob Proteins 2:52-60 Ocana V, de Ruiz Holgado AP, Nader-Macias M (1999) Characterization of a bacteriocin-like substance produced by a
vaginal Lactobacillus salivarius strain. Appl Environ Microbiol 65:5631-5635 Oppegrad C, Rogne P, Emaunelsen L, Kristiansen PE, Fimland G, Nissen-Meyer J (2007) The two-peptide Class II bacteriocins: structure, production, and mode of action. J Mol Microbiol Biotechnol 13:210-219 Parente E, Ricciardi A (1999) Production, recovery and purification of bacteriocins from lactic acid bacteria. Appl Microbiol Biotechnol 52:628-638
Pilasombut K, Sakpuaram T, Wajjwalku W, Nitisinprasert S, Swetwiwathana A, Zendo T, Fujita K, Nakayama J, Sonomoto K (2006) Purification and amino acid sequence of bacteriocins produced by Lactobacillus salivarius K7 isolated from chicken intestine. Songklanakarin J Sci Technol 28:121-131 Pyler EJ (1988) Baking science and technology, 3rd edn. Sosland Publishing Company, Kansas, USA Rollema HS, Kuipers OP, Both P, de Vos WM, Siezen RJ (1995) Improvement of solubility and stability of the antimicrobial
peptide nisin by protein engineering. Appl Environ Microbiol 61:2873-2878 Rosenquist H, Hansen A (1998) The antimicrobial effect of organic acids, sour dough and nisin against Bacillussubtilis and
B. licheniformis isolated from wheat bread. J Appl Microbiol 85:621-631 Sambrook JL, Fritsch EF, Maniatis T (2001) Molecular cloning: a laboratory manual, 3rd edn. Cold Spring Habor Laboratory, Cold Spring Harbor, New York
Sanger F, Coulson AR (1975) A rapid method for determining sequences in DNA by primed synthesis with DNA polymerase. J Mol Biol 94(3):441-448
Sato H, Yanagida F, Shinohara T, Yokotsuka K (2000) Restriction fragment length polymorphism analysis of 16s rRNA genes
in lactic acid bacteria isolated from red wine. J Biosci Bioeng 90:335-337 Schmidt EW Jr, Gould WA, Weiser HH (1969) Chemical preservatives to inhibit the growth of Staphylococcus aureus in
synthetic cream pies acidified to pH 4.5 to 5.0. Food Technol 23:1197-1220 Siriken B, Cadirci O, Inat G, Pamuk S (2009) Microbiological examination of meatball, cream cake and Turkish Delight
(Lokum). J Anim Vet Adv 8(10):2049-2054 Smith JP, Daifas DP, Ei-khoury E, Koukoutsis J, Ei-khoury A (2004) Shelf life and safety concerns of bakery product—a
review. Crit Rev Food Sci Nutr 44:19-55 Stewart CM, Cole MB, Schaffner DW (2003) Managing the risk of staphylococcal food poisoning from cream-filled baked
goods to meet a food safety objective. J Food Prot 66(7):1310-1325 Thompson JM, Waites WM, Dodd CER (1998) Detection of rope spoilage in bread caused by Bacillus species. J Appl Microbiol 85:481-486
Vera Pingitore E, Hebert EM, Nadar-Macias ME, Sesma F (2009) Characterization of salivaricin CRL 1328, a two-pep-tide bacteriocin produced by lactobacillus salivarius CRL 1328 isolated from the human vagina. Res Microbiol 160:401-408
Viedma PM, Abriouel H, Omar NB, Lopez RL, Galvez A (2009) Antistaphylococcal effect of enterocin AS-48 in bakery ingredients of vegetable origin, alone and combination with selected antimicrobials. J Food Sci 74:384-389 Viedma PM, Abriouel H, Omar NB, Lopez RL, Galvez A (2011) Inhibition of spoilage and toxigenic Bacillus species in
dough from wheat flour by the cyclic peptide enterocin AS-48. Food Control 22:756-761 Wehr HM, Frank JH (2004) Standard methods for the microbiological examination of dairy products, 17th edn. APHA Inc, Washington, DC
Wongsuttichote K, Nitisinprasert S (2009) Identification of antimicrobial substance producing lactic acid bacteria isolate
KUB-KJ-174 and its application as a biopreservative substance for bakery products. Kasetsart J 43:796-807 Yamamoto Y, Yoshikazu T, Shimosaka M, Okazaki M (2003) Purification and characterization of a novel bacteriocin produced by Enterococcus feacalis strain RJ-11. Appl Environ Microbiol 69:5746-5753 Zamfir M, Callewaert R, Cornea PC, De Vuyst L (2000) Production kinetics of acidophilin 801, a bacteriocin produced by Lactobacillus acidophilus IBB 801. FEMS Microbiol Lett 190:305-308
Submit your manuscript to a SpringerOpen journal and benefit from:
► Convenient online submission
► Rigorous peer review
► Immediate publication on acceptance
► Open access: articles freely available online
► High visibility within the field
► Retaining the copyright to your article
Submit your next manuscript at ► springeropen.com