Scholarly article on topic 'Enhancement of carotenoid production by disrupting the C22-sterol desaturase gene (CYP61) in Xanthophyllomyces dendrorhous'

Enhancement of carotenoid production by disrupting the C22-sterol desaturase gene (CYP61) in Xanthophyllomyces dendrorhous Academic research paper on "Biological sciences"

CC BY
0
0
Share paper
Academic journal
BMC Microbiology
OECD Field of science
Keywords
{""}

Academic research paper on topic "Enhancement of carotenoid production by disrupting the C22-sterol desaturase gene (CYP61) in Xanthophyllomyces dendrorhous"

Microbiology

RESEARCH ARTICLE Open Access

Enhancement of carotenoid production by disrupting the C22-sterol desaturase gene (CYP61) in Xanthophyllomyces dendrorhous

Iris Loto, María Soledad Gutiérrez, Salvador Barahona, Dionisia Sepúlveda, Pilar Martínez-Moya, Marcelo Baeza, Víctor Cifuentes and Jennifer Alcaíno*

Abstract

Background: Xanthophyllomyces dendrorhous is a basidiomycetous yeast that synthesizes astaxanthin, which is a carotenoid with a great biotechnological impact. The ergosterol and carotenoid synthesis pathways are derived from the mevalonate pathway, and in both pathways, cytochrome P450 enzymes are involved. Results: In this study, we isolated and described the X. dendrorhous CYP6I gene, which encodes a cytochrome P450 involved in ergosterol biosynthesis. This gene is composed of nine exons and encodes a 526 amino acid polypeptide that shares significant percentages of identity and similitude with the C22-sterol desaturase, CYP61, from other fungi. Mutants derived from different parental strains were obtained by disrupting the CYP6I gene with an antibiotic selection marker. These mutants were not able to produce ergosterol and accumulated ergosta-5,8, 22-trien-3-ol and ergosta-5,8-dien-3-ol. Interestingly, all of the mutants had a more intense red color phenotype than their respective parental strains. The carotenoid composition was qualitatively and quantitatively analyzed by RP-HPLC, revealing that the carotenoid content was higher in the mutant strains without major changes in their composition. The expression of the HMGR gene, which encodes an enzyme involved in the mevalonate pathway (3-hydroxy-3-methylglutaryl-CoA reductase), was analyzed by RT-qPCR showing that its transcript levels are higher in the CYP6I mutants.

Conclusions: These results suggest that in X. dendrorhous, ergosterol regulates HMGR gene expression by a negative feedback mechanism and in this way; it contributes in the regulation of the carotenoid biosynthesis.

Keywords: Xanthophyllomyces dendrorhous, Astaxanthin, Ergosterol, Sterol C22-sterol desaturase, Cytochrome P450

Background

Xanthophyllomyces dendrorhous is a basidiomycetous ca-rotenogenic yeast and is one of the few known natural sources of xanthophyll astaxanthin (3,3'-dihydroxy-|3, |3-carotene-4-4'-dione) [1-3]. Carotenogenesis may have evolved as a cellular defense mechanism against oxidative damage from reactive oxygen species (ROS) produced by biochemical and photochemical systems [4-6]. Among carotenoids, astaxanthin stands out for its potent antio-xidant properties and other beneficial effects on human health [7]. Moreover, this pigment has been widely used in

* Correspondence: jalcainog@u.uchile.cl

Laboratorio de Genética. Departamento de Ciencias Ecológicas y Centro de Biotecnología, Facultad de Ciencias, Universidad de Chile, Las Palmeras 3425, Santiago Casilla 653, Chile

BioMed Central

aquiculture to color the flesh of cultured salmonids. Because the characteristic pigmentation is highly desired by consumers, astaxanthin availability has an impact on production costs [8]. Due to its prevalent use in the food, aquiculture, pharmaceutical and cosmetic industries and the increasing demand for natural products, astaxanthin and its sources have great commercial potential [2,8].

Carotenoids are tetraterpenoid compounds that are bio-synthesized in the isoprenoid (also known as terpenoid) pathway (Figure 1); the basic units are isopentenyl-pyro-phosphate (IPP) and its isomer dimethylallyl-pyrophos-phate (DMAPP) [9]. Although an alternate pathway has been described (the deoxyxylulose phosphate, methyle-rithritol phosphate, or nonmevalonate pathway), IPP is synthesized from acetyl-CoA via the mevalonate (MVA)

© 2012 Loto et al.; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

HMGR MVA<—HMG-CoA

^(ERG12)

MVA-P | (ERG8)

MVA-PP ^(MVDl)

Acetyl-CoA ' HMGS ^(ERGIO)

Acetoacetyl-CoA

Mevalonate (MVA) pathway

jpp « ID< » dmapp

GGPP crtYB\

Phytoene era j Lycopene crtYB^ Beta-carotene

crtS/crtRj

Astaxanthin

Astaxanthin biosynthesis

Squalene ^(ERGl)

ERG7■) Lanosterol ^(ERGll)

4,4-dimethyl-eholesta-8,12,24-trienol

Ergosterol biosynthesis

5,7,24(28)-Ergosta-trienol J(2KG5j 5,7,22,24(28)-Ergosta-tetraenol

| (ERG4) Ergosterol

(ERG24)

(ERG25)

(ERG26)

(ERG27)

(ERG6)

(ERG2)

(ERGS)

Figure 1 Mevalonate pathway, astaxanthin and ergosterol biosynthesis. The arrows represent the catalytic step with the respective enzyme-encoding gene described in X. dendrorhous (gene names without brakets and written in black) and S. cerevisiae (genes between brackets and written in blue). The represented X. dendrorhous genes with their Genbank accession number in square brackets are: HMGR [AJ884949], 101 [DQ235686], crtE [DQ012943], crtYB [DQ016503], crtl [Y15007], crtS [EU713462] and crtR [EU884133]. The X. dendrorhous HMGS, FPS and SQS gene sequences are submitted in patents [DI059433.1, DI032788.1 and EA489199, respectively]. The following S. cerevisiae genes are represented: ERG10 [NM_001183842], ERG13 [NM_001182489], ERG12 [AN: NM_001182715], ERG8 [NM_001182727], MV01 [NM_001183220], ERG20 [NM_001181600], ERG1 [M64994], ERG7 [U23488.1], ERG11 [NM_001179137], ERG24 [NM_001183118], ERG25 [NM_001181189], ERG26 [NM_001180866], ERG27 [NM_001181987], ERG6 [NM_001182363], ERG2 [NM_001182709], ERG3 [NM_001181943], ERG5 [NM_001182511], and ERG4 [NM_001180877]. Abbreviations: 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA), mevalonate (MVA), mevalonate-5-phosphate (MVA-P), mevalonate-5-pyrophosphate (MVA-PP), isopentenyl-pyrophosphate (IPP), dimethylallyl-pyrophosphate (DMAPP), geranyl-pyrophosphate (GPP), farnesyl-pyrophosphate (FPP), geranylgeranyl-pyrophosphate (GGPP).

pathway in most eukaryotes [10]. Five genes control this pathway, and among them, the expression of the gene that encodes hydroxymethylglutaryl-CoA (HMG-CoA) reductase, HMGR, is strongly regulated at different levels (transcription, post-translational and proteolysis) [11]. In the isoprenoid synthesis pathway (Figure 1), DMAPP and IPP are condensed by prenyl transferases to form geranyl-pyrophosphate (GPP), and the addition of a second molecule of IPP gives rise to farnesyl pyrophosphate

(FPP) [9]. Squalene, the precursor of sterols, is formed by the condensation of two molecules of FPP by squalene synthase [12]. For the biosynthesis of carotenoids, a third IPP unit is added to FPP, generating geranylgeranyl-pyro-phosphate (GGPP). The condensation of two molecules of GGPP forms the first carotenoid in this biosynthetic pathway, phytoene [13]. During X. dendrorhous carotenogen-esis, lycopene is formed by four successive desaturations of phytoene; cyclization of the ends of lycopene produces

beta-carotene [14]. Unlike other astaxanthin-producing organisms, X. dendrorhous has a single astaxanthin synthase (encoded by the crtS gene) that catalyzes the keto-lation and hydroxylation of beta-carotene to produce astaxanthin [15,16]. This enzyme is related to a 3A subfamily member of the cytochrome P450 protein family [15,16]. Cytochrome P450 proteins (P450s) are heme-containing monooxygenases that are present in organisms from all domains of life [17]; P450s have significant roles in the oxidative metabolism of many exogenous and endogenous substrates [18]. In their active state, these enzymes are reduced by electrons that are supplied by NAD(P)H through a P450 redox partner [19], which in eukaryotes is a cytochrome P450 reductase [20]. In X. dendrorhous, the crtR gene encodes the yeast cytochrome P450 reductase that is essential for the synthesis of as-taxanthin [21]. However, the X. dendrorhous crtR gene is different from the crtR gene originally described in cya-nobacterium Synechocystis sp., which encodes a beta-carotene hydroxylase [22].

Sterols and carotenoids are derived from IPP. Sterols are essential structural and regulatory components of eukaryotic cell membranes, modulating their thickness, fluidity and permeability [23]. Ergosterol is the principal sterol in yeasts, and two cytochrome P450s are involved in its biosynthesis: CYP51 (lanosterol 14-demethylase) and CYP61 (C-22 sterol desaturase), which in Saccharo-myces cerevisiae are encoded by the ERG11 and ERG5 genes, respectively [24] (Figure 1). An erg55 S. cerevisiae mutant strain is viable but unable to synthesize ergos-terol [25]. Interestingly, one of the major bottlenecks in ergosterol biosynthesis is the reaction catalyzed by HMG-CoA reductase [26]. As MVA is a common

precursor in ergosterol and carotenoid biosynthesis, its synthesis should also be an important bottleneck in the biosynthesis of astaxanthin in X. dendrorhous. Based on these observations, this study aimed to identify and characterize the X. dendrorhous C-22 sterol desaturase encoding gene, CYP61, and to evaluate the effect of its disruption on yeast ergosterol production and carotenogenesis.

Results

Cloning and sequence analysis of the CYP61 gene from X. dendrorhous

Our X. dendrorhous genomic database was analyzed with the BLAST tool of the CLC Genomics Workbench 5 software using as query several CYP61 gene sequences available in the GenBank database. In this way, we were able to identify a putative CYP61 gene (hereafter CYP61 gene) from X. dendrorhous, which allowed us to design specific primers to amplify and clone this gene.

A fragment of approximately 4,200 bp [GenBank: JX183236] was PCR-amplified using genomic DNA from strain UCD 67-385 as a template and the primer set CYP61up2.F + CYP61dw2.R (Table 1). This fragment was inserted at the EcoRV site of the pBluescript SK-plasmid, generating pBS-gCyp61. In parallel, the X. den-drorhous CYP61 cDNA was screened in a cDNA library by PCR using plasmid DNA from different clone mixtures as templates and the primer pair CYP61.F + CYP61.R (Table 1). The recombinant plasmid pBS-cCyp61, which contained the CYP61 gene cDNA with an ORF of 1,581 bp [GenBank: JX183235], was isolated. The sequence analysis of the genomic and cDNA versions of the CYP61 gene allowed us to determine that this gene consists of nine exons of 156, 152, 114, 75, 81, 441, 169, 320 and 73

Table 1 Primers designed and used in this work

N° Primer Sequence 5' to 3' Target

1 H-out.F CTCGATGAGCTGATGCTTTG Hygromycin B resistance cassette

2 H-out.R TCCATCACAGTTTGCCAGTG Hygromycin B resistance cassette

3 Zeo.F TGAACAGGGTCACGTCGT Zeocin resistance cassette

4 Zeo.R CGCTGATGAACAGGGTCAC Zeocin resistance cassette

5 CYP61up2.F CTGGAGCCGAATTCATTGAT CYP61 gene

6 CYP61dw2.R AGGAGGCAGAGTGGTTGAGA CYP61 gene

7 CYP61b.F GTCGGAGGAAGAGCAGTTTG CYP61 gene

8 CYP61.F CTGAGCCCTGTCTTGTTGCC CYP61 gene

9 CYP61.R ATTGTACACCTTTGTTCCAGGC CYP61 gene

RT-qPCR (The pairs of primers used had efficiency greater than 95%, as determined by standard curves with a correlation coefficient of

10 mactF-RT CCGCCCTCGTGATTGATAAC ACT gene

11 mactR-RT TCACCAACGTAGGAGTCCTT ACT gene

12 hmgR.F-RT GGCCGATCGCTATACATCCGTTT HMGR gene

13 hmgR.R-RT ATCCAGTTGATGGCAGAAGGCT HMGR gene

F and R in the primer name indicate the primer orientation.

CYP61 jp2.F t t Cyp61 F. t t

E1 E2 E3E4E5 E6 E7 E8 E9

4 ^Cyp61 R cCyp61-R^Cyp61ciw2.R

Exon (E) or Intron (I) E-1 I-1 E-2 I-2 E-3 I-3 E-4 I-4...

Position (pb) s s 3 a 3 s s 159 182 189 200 232 233 253 256 290 292 318 325 334 361 365 376/377 415 423 454 461 470 482 506 545 590 593 628 645 648 651 662 670 671 672 723 732 825 835 845 846 867 870 893 894/895 904 909/910 945 963 94 95 96

UCD67-385 CBS6938 VKMY2786 UCD67-210 AVHN2 ANCH03 ANCH07 ANCH10 AG T C G G C AG T C G G C AG T C G G C AG T C G G C G A C T A A T G A C T A A T G A C T A A T G A C T A A T CATTGATAGATACTC - AGACA CATTGGTGTATACTC-AGACA CA - TGGTGTATACTC-AGACA CATTGATAGATACTC - AGACA TGTCTACGTGCCTCTCCCGTG TGTCTACGTGCCTCTCCCGTG TGTCTACGTGCCTCTCCCGTG TGTCTACGTGCCTCTCCCGTG T T T C G T T T C G T T T C G T T T C G C C C T A C C C T A C C C T A C C C T A GTCTCATC GTCTCATC GTCTCATC GTCTCATC AGTCTGCT AGTCTGCT AGTCTGCT AGTCTGCT C T C T C T C T T C T C T C T C A A A A C A T - T -AAAAC A T - T -AAAAC A T - C -ACAAC A T - C -G C G T T G C C C -G C G T T G C C C A G C G T T G C C C -G C G T T G C C C - T T T T T T T T C C C C C C C C C T A C T A C T A C T A T C G T C G T C G T C G

Exon (E) or Intron (I) ...I-4 E-5 I-5 E-6 I-6 E-7 I-7 E-8 I-8 E-9

Position (pb) 1012 1031 1062 1094 1100 1103 1139 1145 1154 1150 1159 1178 1086 1192 1193 1204 1206 1216 1221 1224/1225 1226 1262 1295 1322 1361 1457 1573* 1683 1687 1702 1744 1800 1824 1923 1937 1943 1960 1968 1969 1970 1978 2076* 2138 2147 2207 2216 2231 2306 2368/2369 2381 2382 2443 2445 2454 2467 2468 2516 2537

UCD67-385 CBS6938 VKMY2786 UCD67-210 AVHN2 ANCH03 ANCH07 ANCH10 T C C T C C T C C T C C C T T C T T C T T C T T G T T C C G T T C C G T T C C G T T C C A C A T T A C A T T A C A T T A C A T T CCGCCTTATGT - C CCGCCTTATGT - C CCGCATTATGT - C CCGCCTTATGT - C GTA-CCAGCACTT GTA-CCAGCACTT GTA-CCAGCACTT GTA-CCAGCACTT T A C A T G T A C A T G T A C A T G T A C A T G C G T A A A C G T A A A C G T A A A C G T A A A T G T T T G T T T G T T T G T T C A C C C A C C C A C C C A C C G C C G C C G C C G T C ATT ATT ATT ATT T C C G A T A T C C G A T A T C C G A T A T C C G A T A C T T T - C T C T T T - C T C t T T - C T C T T T - C T C C T A A T G C C T A A T G CCTAATG CCTAATG T T C G G C A T T C G G C A TTCGGCA TTCGGCA --- T A T C G G T --- T A T C G G C --- T A T C G G C --- T A T C G G C CCT G G C T A A C CCT G G C T A A C CCT G G C T A A C CCT G G C T A A C T C T C T C T C C T C T C T C T

Figure 2 Structure and sequence comparison of the CYP61 gene from X. dendrorhous. (A) PCR-amplified DNA region that includes the CYP61 gene from X. dendrorhous. The nine exons of the CYP61 gene are shown in thick red arrows (E1 to E9) and the recognition site of primers used in this work are represented by thin arrows. (B) Sequence comparison of CYP61 genes from different X. dendrorhous strains: UCD 67-385 [GenBank: JX183236], CBS 6938 [GenBank: JX183240], VKM Y-2786 [GenBank: JX183238], UCD 67-210 [GenBank: JX183237], AVHN2 [GenBank: JX183239], ANCH03 [GenBank: JX183241], ANCH07 [GenBank: JX183242] and ANCH10 [GenBank: JX183243]. The base changes are showr indicating their position in bp, with the adenine of the translation start codon as bp 1. The respective exon (E-1 to E-9) or intron (I-1 to I-8) where the base changes occur is also indicated.

bp, and eight introns of 317, 82, 90, 83, 84, 79, 116 and 111 bp (Figure 2A). The CYP61 gene encodes a putative 526 amino acid CYP61 protein with a predicted molecular weight of 59.6 kDa and pi of 6.48. The CYP61 deduced protein from X. dendrorhous shares 43% identity and 65% similarity at 95% sequence coverage with the Saccharomyces cerevisiae C22-sterol desaturase (CYP61, Swiss-Prot: P54781.1). This protein belongs to the cy-tochrome P450 protein family and is involved in the second last step of the ergosterol biosynthesis, the conversion of 5,7,24(28)-ergostatrienol into 5,7,22,24(28)-ergostatetraenol [25].

The CYP61 gene from several X. dendrorhous strains (VKM Y-2786, CBS 6938, UCD 67-210, ANCH03, ANCH07, ANCH10 and AVHN2 (Table 2) was PCR-amplified using Pfu DNA pol, and each amplicon was sequenced [GenBank: JX183238, JX183240, JX183237, JX183241, JX183242, JX183243 and JX183239, respectively]. We found several base changes, but most of them

were located in the intronic regions. Only four base changes produced amino acid replacements; the adenine, guanine, guanine and cytosine at positions 34, 79, 1,573 and 2,075 were converted to guanine, adenine, adenine and thymine (numeration according to the CYP61 gene translation start in strain UCD 67-385), resulting in T12A, A27T, R306K and P409S variations at the deduced amino acid sequence, respectively (Figure 2B).

Even though the amino acid sequences are extremely diverse among the cytochrome P450 protein family, their structural fold is highly conserved [27]. Several cytochrome P450 secondary structural elements in the deduced CYP61 protein from X. dendrorhous were predicted with the CYP450 Engineering database [28] (Figure 3). This included alpha helices A, B, C, D, F, G, H, I, J, K, K' and L, beta-sheets 1-1, 1-2, 1-5, 3-1, 1-4, 2-1, 2-2, 1-3, 3-3, 4-1, 4-2 and 3-2, the meander loop, which may be involved in the stabilization of the tertiary structure and heme binding, and the Cys pocket that contains the

Table 2 Strains and Plasmids used and built in this work

Genotype or relevant features

Source or reference

Strains: E. coir. DH-5a

X. dendrorhous: UCD 67-385

385-cyp61

385-cyp61

CBS 6938 CBS-cyp61

AVHN2 Av2-cyp61

UCD 67-210

VKM Y-2786

ANCH03*

ANCH07*

ANCH10*

Plasmids:

pBluescript SK- (pBS) pMN-hph

pIR-zeo

pBS-gCyp61

pBS-cyp61/Hyg

pBS-cyp61/Zeo pBS-cCyp61

F- 980d lacZAM15A (lacZY-argF) U169 deoR recA1 endA1 hsdR17(rk- mk+) phoA supE44l- thi-1 gyrA96 relA1

ATCC 24230, wild type. Diploid strain [30]

(385-CYP61/cyp61hph). Heterozygote transformant derived from UCD 67-385 containing an allele of the CYP61 locus interrupted with a hygromycin B resistance cassette.

(385-cyp61hph/cyp61zeo). Homozygote transformant derived by transformation of 385-cyp61+/-with both CYP61 alleles interrupted, one with a hygromycin B resistance cassette and the other with a zeocin resistance cassette.

ATCC 96594, wild type.

(CBS-cyp61hph). Hemizygote transformant derived from CBS 6938. The single CYP61 locus was interrupted with a hygromycin B resistance cassette.

Chilean native isolate, wild type.

(Av2-cyp61zeo). Hemizygote transformant derived from AVHN2. The single CYP61 locus was interrupted with a zeocin resistance cassette.

ATCC 24202, wild type (Phaffia rhodozyma)

Wild-type strain.

Chilean Antarctic native isolate, wild type. Chilean Antarctic native isolate, wild type. Chilean Antarctic native isolate, wild type.

ColEl ori; AmpR; cloning vector with blue-white selection

pBS containing at the EcoRV site a cassette of 1.8 kb bearing the E. co//-Hygromycin B resistance (hph) gene under EF-1 a promoter and GPD transcription terminator of X. dendrorhous.

pBS containing at the EcoRV site a cassette of 1.2 kb bearing the Streptoa//ote/chus h/ndustanus Zeocin resistance Sh b/e gene under EF-1 a promoter and GPD transcription terminator of X. dendrorhous.

pBS containing at the EcoRV site a 4,224 bp DNA fragment containing the X. dendrorhous CYP61 gene amplified by PCR with primers CYP61up2.F and CYP61dw2.R.

pBS-gCyp61 bearing the Hygromycin B resistance cassette at the EcoRV site that interrupts the CYP61 gene.

pBS-gCyp61 bearing the Zeocin resistance cassette at the EcoRV site that interrupts the CYP61 gene. pBS bearing the cDNA of the CYP61 gene. The cDNA measures 1,752 bp with an ORF of 1,581 bp.

This work This work

ATCC This work

Our Lab collection This work

ATCC VKM

Our Lab collection Our Lab collection Our Lab collection

Stratagene [31]

This work

This work

This work

This work This work

*: X. dendrorhous Chilean native isolates confirmed by ITS, D1/D2 and IGS regions sequences. The following abbreviations are used for microorganism culture collections: CBS, Centraalbureau voor Schimmelcultures, Utrecht, Netherlands; ATCC, American Type Culture Collection, Manassas, USA; UCD, Phaff Yeast Culture Collection, Department of Food Science and Technology, University of California at Davis, Davis, USA; VKM, The All-Russian Collection of Microorganisms, Moscow, Russia.

conserved cysteine involved in heme binding. There are three totally conserved amino acids in the cytochrome P450 protein family, the glutamic acid and arginine of the E-X-X-R motif at the K-helix, which are involved in stabilizing the core and heme binding, and the heme binding cysteine [28], and these residues are present in the predicted CYP61 protein. Additionally, we were able to predict the putative hydrophobic transmembrane segment at the CYP61 amino terminus, which could anchor the protein to the endoplasmic reticulum [29].

The CYP61 gene mutation

To study the function of the CYP61 gene in X. dendrorhous, mutant cyp6r strains were generated. The wild-type strains UCD 67-385 and CBS 6938 were transformed with plasmid pBS-cyp61/Hyg, and strain AVHN2 was transformed with plasmid pBS-cyp61/Zeo. All transformations were performed with linearized plas-mids as indicated in Figure 4. Through a double homologous recombination event, the donor DNA fragment containing the CYP61 gene interrupted by one of the

masghvpapsstasafpfslsgteafafpelttrTLLGSILrwaSILIFEOIWyrnkkq 60

««transmembrane»»

hlpgptwtipiigkflnslhptmeVYKftQFAQGELSAFS 'fhl lVMAVSNKVARKIfl 120

<<h-A»Xbl-l» <bl-2»«h-B>>

DYAEP lvasakqvllpenwvflhg] VHAEYRRALNVLFTR 1siYLPIQEKIYRRYF 180 <bl-5 «««h-C»»» <<««h-D»»

MEwmndpdtepkpYMMVMRDlnmetslrvfcgehmseeeqfaisdkyKLTTCALQlvnfp 24 0 » <<b3-l>> <<h-F»>

lalpgtkvynaikarJrXJUfriiBDVSAkskrsmaegneptclidaWMKEMXiJAkagkges 300 <««h-G>»> <<h-H»>

saeerralsrefsdhe MWLSFLFASQDAMTSALVNTFELLADHPEILAKVRE qyyv 360 «««««««h-i»»»>»»»«h-J>> * * i

rhndvdaplsfnqmdem\YTRAMVKEALRLIP ifvPYLTL PFPIL YTVPK MLI 420

«««h-K»»> <bl-4 <b2-l <b2-2 bl-

PS wpsCHDET lalilikMisMg fikaasafianpknk'iiA'MefcWilili<4<g|EYAYMHLAA 48 0

3> <h-K' <meander> «Cys pocket»«<«<h-L

CVGTASVTMDffRRKI pdt KFQV at LFPKD jlHLKFtprpkpsi 526 >»>»>»»b3-3 b4-l b4-2 b3-2

Figure 3 Deduced X. dendrorhous CYP61. Secondary structuralelements were predicted with the CYP450 Engineering database, and the potentialtransmembrane region was predicted with TMpred. Structuralelements are in capitalletters with the name of the corresponding feature underneath them. Underlined and in italics: possible transmembrane helix. In bold and italics: alpha helices. Underlined: Beta-sheets. Ir white letters and highlighted in black: meander loop and Cys pocket. The asterisks (*) indicate the three totally conserved amino acids among cytochromes P450, and the exclamation points (!) show the amino acid variation found in the deduced CYP61 from different X dendrorhous strains.

two resistance markers replaced the CYP61 gene in the yeast chromosome. In this way, we obtained the transformant strains 385-cyp61hph, CBS-cyp61hph and Av2-cyp61zeo (Table 2). The genotype modifications in the transformant strains were validated by PCR reactions using specific primers for the CYP61 gene, zeocin or hygromycin B resistance cassettes (Table 1) and genomic DNA from the parental and transformant strains. The amplicons confirmed the CYP61 gene interruption (Figure 5). However, as strain UCD 67-385 is diploid [30] and we were able to detect a CYP61 wild-type allele, the resulting strain 385-cyp61hph is heterozygous (385-CYP61/ cyp61hph). For this reason, strain 385-CYP61/cyp61hph was transformed with the linearized plasmid pBS-cyp61/Zeo obtaining the cyp61- homozygote mutant strain 385-cyp61hph/cyp61zeo (Figure 5). The ploidy levels of strains CBS 6938 and AVHN2 are unknown; based on random mutagenesis experiments and by transformation of carote-nogenic genes performed at our laboratory [21,31], we estimate that these strains are aneuploid. In these cases, the PCR-based genotype analysis determined that a unique CYP61 gene copy was mutated in strains CBS-cyp61hph and Av2-cyp61zeo (Figure 5), indicating that these strains are hemizygous, so a second transformation event was not

necessary in these mutants. Interestingly, a clear difference in the color phenotype could be distinguished among all the cyp61- mutants and their corresponding parental strains, indicating alterations in carotenoid biosynthesis (see below).

CYP61 gene mutant phenotype evaluation: ergosterol and carotenoid production

To analyze and compare the cyp61~ mutant phenotypes, the seven strains UCD 67-385, 385-CYP61/cyp61hph, 385-cyp61hph/cyp61zeo, CBS 6938, CBS-cyp61hph, AVHN2 and Av2-cyp61zeo were cultivated in YM complete medium for 5 days at 22°C with constant agitation. Growth was measured by the culture absorbance at 600 nm, and samples were taken after 24, 72 and 120 h of cultivation. The samples were processed to determine the yeast dry weight and to extract sterols, carotenoids and RNA as described in the Materials and Methods section.

As in other species, the CYP61 gene is involved in the ergosterol biosynthesis, so we evaluated the sterol production and composition in the cyp61- mutants by RP-HPLC. Figure 6 shows representative chromatograms obtained from sterols extracted from strains UCD 67385 and 385-cyp61hph/cyp61zeo, representing the parental

Figure 4 Plasmids constructed in this work. In each plasmid illustration, relevant features for this work, such as endonuclease recognition sites and primer binding sites (thin arrows), are shown. Some elements of the originalplasmid (pBluescript SK-) were kept and shown in gray. Plasmid pBS-gCyp61 harbors the genomic version of the CYP61 gene from X. dendrorhous that was PCR-amplified with primers CYP61up2.F and Cyp61dw2.R. Red thick arrows along with a number represent the nine exons of the CYP61 gene. Plasmids pBS-Cyp61/Hyg and pBS-Cyp61/Zeo were built by inserting the hygromycin B (HygR, in green) and zeocin (ZeoR, in violet) resistance expression cassettes, respectively, at the EcoRV site of plasmid pBS-gCyp61. To linearize the plasmids for transformation purposes, pBS-Cyp61/Hyg and pBS-Cyp61/Zeo were digested with Xbal.

cyp61hn¡lm allele: PCR product (kb): y

CYP61 allele: PCR product (kb):

Figure 5 PCR-based analysis of cyp61 mutants. Each gelshows PCR reactions performed with different sets of primers and genomic DNA from strains UCD 67-385 (lane 1), 385-CYP61/cyp61hph (lane 2), 385-cyp61hph/cyp61zeo (lane 3), CBS 6938 (lane 4), CBS-cyp61hph(lane 5), AVHN2 (lane 6), Av2-cyp61zeo (lane 7), and a negative controlwithout DNA (lane 8). The diagram below each gelrepresents the amplification target (cyp61- mutant or wild-type allele) and the size of the expected amplicon. The colors represent the resitance cassettes HygR in green and ZeoR i violet, the CYP61 gene in red and the CYP61 flanking DNA in dark grey. The EcoRV recognition site, where the respective antibiotic resistance marker was inserted to disrupt the CYP61 gene, is also shown. Molecular weight standard were: lambda DNA/Hind III (23.1, 9.4, 6.6, 4.4, 2.3, 2.0 and 0.6 kbp) at the left, and 1 kb DNA ladder (10.0, 8.0, 6.0, 5.0, 4.0, 3.5, 3.0, 2.5, 2.0, 1.5, 1.0, 0.75 and 0.5 kbp) at the right, of each gel.

mAU 300

: B UCD 67-3 85 + ergosterol

C 385-cyp61 hp)cyp612

mAU 600 400 200 0-

3 600,

100 • 0

D 385-cyp61hp^lcyp61 + ergosterol

mAU. 200

3 200-1 100 -

' 11 10

Figure 6 RP-HPLC sterols analysis from UCD 67-385 and 385-cyp61hph/cyp6 1zeo strains. Chromatograms (at 280 nm) correspond to sterols extracted from strains as described in the Materials and Methods section. Beside each peak (peaks N° 1 to 3), the corresponding spectra were included. Sterols were analyzed from UCD 67-385 wild-type (A), UCD 67-385 wild-type co-injected with standard ergosterol(B), 385-cyp61hph/ cyp61zeo mutant (C) and 385-cyp61 hph/cyp61zeo co-injected with standard ergosterol. Ergosterolcorresponds to peak N° 1.

and the cyp61~ mutant strains, respectively. In wild-type strains, we observed a predominant peak (peak 1) at the 280 nm channel at approximately 18 min with the ergosterol characteristic spectra (Figure 6 A), and its identity was confirmed by co-injecting each sample with

standard ergosterol (Figure 6 B). On the other hand, in the analysis of the sterols from the homozygous and hemizygous cyp61~ mutants, two peaks were observed with retention times close to 15 (peak 2) and 21 min (peak 3) (Figure 6 C, Table 3). These two peaks did also

Table 3 Sterol composition according to their RP-HPLC profile of wild-type and cypôl X. dendrorhous mutant strains (in mg/g dry yeast weight)

Strains

UCD 67-385 385-cyp61(+/-) 385-cyp61(-/-)

Cultivation time (h) 24 72 120 24 72 120 24 72 120

Ergosterol* 4.74±0.53 3.10±0.09 2.24±0.42 3.19±0.48 2.87±0.32 2.91±0.34 ND ND ND

Peak 2** 0.23±0.03 0.030±0.003 0.10±0.05 0.62±0.05 0.11±0.03 0.12±0.02 6.34±2.68 2.36±0.74 2.39±0.27

Peak 3*** 0.19±0.04 ND 0.09±0.02 0.11±0.01 0.02±0.01 0.01±0.003 1.65±0.84 1.91±0.51 2.20±0.42

Total Sterols 5.16±0.57 3.13±0.09 2.40±0.49 3.96±0.44 2.99±0.35 3.04±0.36 8.14±3.42 4.27±1.24 4.59±0.70

Strains

CBS 6938 CBS-cyp61(-)

Cultivation time (h) 24 72 120 24 72 120

Ergosterol* 3.31±0.60 2.39±0.56 2.37±0.11 ND ND ND

Peak 2** 0.07±0.04 0.06±0.02 0.06±0.01 2.00±0.34 1.24±0.02 1.23±0.04

Peak 3*** 0.03±0.001 0.02±0.01 0.03±0.01 2.38±0.29 2.60±0.08 3.05±0.17

Total Sterols 3.45±0.56 2.41 ±0.59 2.46±0.11 4.38±0.61 3.85±0.1 4.28±0.21

Strains

AVHN2 AV2-cyp61-)

Cultivation time (h) 24 72 120 24 72 120

Ergosterol* 1.59±0.62 2.35±0.59 3.27±0.38 ND ND ND

Peak 2** ND 0.04±0.01 0.04±0.01 1.68±0.78 2.10±0.32 1.78±0.13

Peak 3*** ND ND ND 1.39±0.82 2.27±0.18 2.39±0.52

Total Sterols 1 59±0.62 2.39±0.59 3.31 ±0.39 3.16±1.70 4.36±0.49 4.11 ±0.64

Table shows the mean values ± standard deviations of three independent experiments. Retention time: *: 18 min; **: 15 min; ***: 22 min. ND: Not detected.

have the sterols characteristic spectra, but their retention time was different than that of ergosterol. This last observation was also confirmed by co-injecting the extracted sterols with standard ergosterol, resulting in three peaks at approximately 15, 18 and 22 min (Figure 6 D). Additionally, the identity of the sterols was determined by GC-MS (Additional file 1: Figure S1), confirming that wild-type strains produced mainly ergosterol and that the mutants instead accumulated ergosta-5,8,22-trien-3-ol and ergosta-5,8-dien-3-ol. Considering the relative abundance of each sterol obtained by GC-MS and RP-HPLC, peaks 2 and 3 in the RP-HPLC chromatogram from the cyp61 mutant strain (Figure 6 C) should correspond to ergosta-5,8-dien-3-ol and ergosta-5,8,22-trien-3-ol, respectively.

Table 3 summarizes the sterol composition of the seven strains at different cultivation times. In general, when compared to the corresponding parental strain, the total sterol content was greater in the cyp61- mutants. In addition, the sterols produced by the cyp61~ mutant strains corresponding to peaks 2 and 3 were at ratios of 55% and 44%, 32% and 68%, 48% and 52% in the 385-cyp61hph/ cyp61zeo, CBS-cyp61hph, Av2-cyp61zeo strains, respectively. In the heterozygous strain 385-CYP61 /cyp61hph, the main sterol produced was ergosterol.

A visible change in the color of the cyp61 mutants was evident when compared to their corresponding parental

Figure 7 Color phenotype of cyp61 mutant and wild-type strains. Cultures in solid YM complete media of strains UCD 67-385 (1), 385-CYP61 /cyp61hph (2), 385-cyp61hph/cyp61zeo (3), AVHN2 (4), Av2-cyp61zeo (5), CBS 6938 (6) and CBS-cyp61hph (7).

Table 4 Carotenoid composition of wild-type and cyp61 X. dendrorhous mutant strain (in ppm)

Strains

UCD 67-385 385-cyp61(+/-) 385-cyp61(-/-)

Cultivation time (h) 24 72 120 24 72 120 24 72 120

Astaxanthin 52.6±22.3 26.3±2.7 224.0±42.1 89.1±13.4 34.9±5.1 223.7±8.6 126.5±31.0 49.8±18.2 434.7±56.2

Phoenicoxanthin ND ND ND ND ND ND ND ND ND

Cantaxanthin ND ND 13.4±3.3 ND ND ND ND ND ND

HO-keto-y-carotene ND 1.0±0.5 ND ND 1.9±0.3 ND ND 2.2±1.3 ND

HO-keto-torulene 2.6±1.1 1.1±0.2 30.1±6.7 ND ND 35.5±1.0 ND ND 62.1±7.3

Keto-y-carotene 8.0±4.9 2.7±1.4 7.8±1.9 ND 1.2±0.6 9.7±1.0 ND 5.7±2.9 21.4±7.9

HO-echinenone 1.8±0.6 1.2±0.9 2.6±0.5 ND 2.6±0.5 9.2±0.4 ND 3.6±1.6 15.6±4.4

Echinenone ND ND 2.0±0.4 ND ND ND ND ND ND

Lycopene 4.0±2.0 ND ND ND 1.4±0.7 1.1±1.0 ND 4.3±1.9 ND

y-carotene ND 0.2±0.03 2.7±0.5 ND ND ND ND 0.8±0.4 ND

P-carotene 1.1±0.5 0.8±0.3 2.7±1.1 ND 1.7±1.0 6.3±0.8 ND 4.8±3.5 15.8±9.1

Total carotenoids 70.7±26.9 36.1 ±8.6 290.1 ±53.4 89.1 ±13.4 47.6±7.1 293.7±9.1 126.5±31 .0 78.2±26.2 555.1 ±75.2

Strains

CBS 6938 CBS-cyp61(-)

Cultivation time (h) 24 72 120 24 72 120

Astaxanthin 32.1±11.2 202.0±17.7 324.2±6.7 62.8±5.4 313.5±24.1 429.3±26.5

Phoenicoxanthin 13.7±8.0 8.1±2.1 ND ND ND ND

Cantaxanthin ND ND ND ND ND ND

HO-keto-y-carotene 2.9±1.4 9.5±0.6 ND 2.7±2.0 ND 12.2±10.5

HO-keto-torulene ND 20.1±3.6 25.6±12.4 ND 76.4±8.3 72.8±18.0

Keto-y-carotene 9.8±4.6 32.8±4.6 29.8±0.45 7.1±0.8 50.2±3.5 33.0±2.97

HO-echinenone 1.4±0.8 21.9±5.2 15.7±0.6 3.9±0.1 24.1±1.6 18.8±1.0

Echinenone ND ND ND ND ND ND

Lycopene 16.0±1.3 ND ND 11.9±4.9 3.2±0.5 2.9±0.1

y-carotene 2.4±2.0 7.3±1.6 7.6±0.5 ND 8.8±0.2 15.3±1.7

P-carotene 0.4±0.2 33.2±6.8 20.4±0.7 1.8±1.2 41.8±4.2 31.2±1.4

Total carotenoids 78.9±21.3 347.2±36.9 453±11.1 91.9±7.44 530.3±21 .4 625.8±22.9

Strains

AVHN2 AV2-cyp61(-)

Cultivation time (h) 24 72 120 24 72 120

Astaxanthin 15.2±0.8 116.5±7.0 131.8±20.6 16.3±6.1 118.0±59.2 143.0±64.8

Phoenicoxanthin ND ND ND ND ND ND

Cantaxanthin ND ND ND ND ND ND

HO-keto-y-carotene ND 20.0±1.2 17.9±2.8 ND 25.3±7.8 36.8±16.7

HO-keto-torulene 0.7±0.4 27.0±10.4 21.1±2.6 1.1±0.9 62.8±22.3 40.6±9.9

Keto-y-carotene 3.0±1.07 ND ND 1.7±0.7 13.1±9.25 ND

HO-echinenone 2.1±0.6 10.9±5.7 9.9±0.9 ND 9.3±7.3 13.6±2.6

Echinenone ND ND ND ND ND ND

Lycopene 1.4±1.0 ND ND ND 4.0±2.5 ND

y-carotene ND 0.8±0.1 ND ND 2.2±1.7 1.1±0.9

P-carotene 1.0±0.5 19.7±12.0 12.0±2.9 1.9±0.9 25.4±7.6 20.4±4.7

Total carotenoids 24.9±2.8 195.3±33.7 193.4±19.0 25.0±6.9 274.6±24.1 258.6±76.7

Table shows the mean values ± standard deviations of three independent experiments. ND: Not detected.

strain (Figure 7). The first ones had a more intense red color, suggesting that the mutant strains produced more carotenoids. This observation was confirmed by carotenoid extraction and quantification from the seven strains after 24, 72 and 120 h of cultivation; the pigment composition was analyzed by RP-HPLC (Table 4). The cyp61~ mutants produced more carotenoids than their corresponding parental strains without other major alterations in their composition. In all cases, the maximum carotenoid content was reached after 120 h of cultivation, which coincides with the late stationary phase of growth (Figure 8). In general at this time, the major differences in total carotenoid content were observed among the analyzed strains. The total carotenoid contents relative to the parental strains after 24, 72 and 120 h of cultivation, respectively, were as follows: 126%, 132% and 101% in strain 385-CYP61 /cyp61hph; 179%, 217% and 191% in strain 385-cyp61hph/cyp61zeo; 116%, 153% and 138% in strain CBS-cyp61hph and 100%, 141% and 134 % in strain Av2-cyp61zeo (Table 4).

Expression analysis of the HMGR gene

In Schizosaccharomyces pombe, Cryptococcus neoformans and mammalian cells, the expression of the HMG-CoA re-ductase encoding gene (HMGR) is regulated by sterols [11,32,33]. In X. dendrorhous, only one HMGR gene [GenBank: AJ884949] has been identified, and its deduced amino acid sequence shares 58% identity and 73.4% similarity with HMG1, one of the two HMG-CoA reductases in S. cerevisiae [34]. Thus, it is possible that the X. dendrorhous cyp61 mutants have a higher HMGR transcript level, which could explain the increase in carotenoid content. We quantified the HMGR mRNA level by RT-qPCR at different timepoints on the growth curve of the seven analyzed strains. Figure 8 shows the relative expression of this gene normalized to the housekeeping beta-actin gene [35]. The HMGR gene expression pattern was different between the cyp61 mutants and their parental strains. While its expression is relatively constant in the wild-type strains, its expression in the 385-cyp61hph/cyp61zeo, CBS-cyp61hph and Av2-cyp61zeo mutants increases along the growth curve, reaching expression levels almost 23, 12 and 73 times higher, respectively, than the wild-type strains after 120 h of cultivation. At 24 and 72 h of cultivation, the expression of this gene was between 2 and 5 times higher in the 385-cyp61hph/cyp61zeo, CBS-cyp61hph and Av2-cyp61zeo strains than in the respective parental strains (Figure 8).

Figure 8 RT-qPCR expression analysis of the HMGR gene along the growth curve in wild-type and cyp61 mutant strains. The

HMGR gene expression in the mutant strains was determined with respect to the control(wild-type strain). A) Strains UCD 67-385, 385-CYP61/cyp61hph and 385-cyp61hph/cyp61zeo B) CBS 6938 and CBS-cyp61hph. C) AVHN2 and Av2-cyp61zeo. Values are the mean ± standard error of three independent experiments.

Discussion

Cytochrome P450 monooxygenases are involved in the oxidative metabolism of an enormous diversity of substrates, taking part in primary, secondary and xenobiotic metabolism. CYP51 and CYP61 are structurally and functionally conserved fungal P450s involved in membrane ergosterol biosynthesis [36], and the role of CYP61 as a

C22-desaturase in fungal membrane sterol synthesis has been elucidated in S. cerevisiae [24] and Candida glabrata [37]. In this study, we isolated and characterized a gene, CYP61, from X. dendrorhous that has nine exons, encodes a putative 526-residue polypeptide and shares significant similitude and identity with the C22-sterol desaturase

from S. cerevisiae [25]. We could predict several P450 characteristic secondary structural elements, and we identified three residues in CYP61 that are completely conserved in P450s. Together, these observations support the hypothesis that the X. dendrohous CYP61 gene encodes the cytochrome P450 CYP61.

As in other organisms [25], the CYP61 gene is not essential for the X. dendrorhous viability, even though we demonstrated that it is involved in ergosterol biosynthesis. Disruption of the CYP61 gene prevents ergosterol biosynthesis and leads to the accumulation of other intermediary sterols including ergosta-5,8-dien-3-ol and ergosta-5,8,22-trien-3-ol. Contrary to our findings, the specific mutation of ERG5 in S. cerevisiae results in the predominant accumulation of ergosta-5,7-dien-3-ol, although the C22-desaturase substrate is ergosta-5,7,24-trien-3-ol [25,38]. Like in X. dendrohous, ergosta-5,8, 22-trien-3-ol accumulation has been observed in other fungi, such as C. neoformans, after the inhibition of the ERG6-encoding enzyme [39] and in nystatin-resistant Neurospora crassa strains that are unable to produce ergosterol [40]. Although our second found intermediary, ergosta-5,8-dien-3-ol, is an atypical sterol, it has been detected in fungi strains that are unable to synthetize er-gosterol that in turn are resistant to fungicidal polyenes, such as nystatin and primaricin; polyenes bind ergosterol in the fungal cell membrane, creating channels that disrupt the transmembrane potential and its functions [41]. This phenomenon was observed in a nystatin-resistant S. cerevisiae strain [42] and primaricin-resistant Aspergillus nidulans strains [43]. Clearly, these observations and our results indicate the existence of alternative sterol biosynthesis pathways, which require further studies.

Because the cyp61~ mutant strains were viable without significant changes in their growth (at least in our experimental conditions), ergosta-5,8,22-trien-3-ol and/or ergosta-5,8-dien-3-ol may play roles similar to ergosterol in the X. dendrorhous cell membrane. Finally, even though the cyp61 mutant strains were not able to produce er-gosterol, their sterol content was higher compared to the corresponding parental strains, suggesting an ergosterol-mediated feedback regulatory mechanism in the sterol biosynthesis pathway of X. dendrorhous.

In addition to the alterations in sterol content and composition, the cyp61~ mutant X. dendrorhous strains exhibited color phenotypes dissimilar to their parental strains (Figure 7). Carotenoid analyses revealed that the mutant strains produced more carotenoids (Table 4), demonstrating that the CYP61 gene mutation affected carotenoid biosynthesis. Major differences were observed after 72 and 120 h of culture, which coincide with the early and late stationary phases of growth (Figure 8). Wozniak and co-workers reported that maximum expression levels of carotenogenic genes are reached by the end

of the exponential and beginning of the stationary phase of X. dendrorhous growth [44], coinciding with the induction of carotenogenesis [45]. It is expected that greater differences in the carotenoid content would be observed once carotenogenesis is induced.

Similar to our results, other studies have demonstrated an increase in astaxanthin production in Phaffia rhodo-zyma (anamorphic state of X. dendrorhous) when the ergosterol levels were reduced by fluconazole treatment [46]. A possible explanation for the increased carote-noids in the cyp61~ mutants could be the greater availability of carotenoid precursors in absence of the ergosterol negative feedback regulation. This reasoning is also supported by the fact that in the cyp61- mutants, the total sterol content was also increased. For example, supplementation of P. rhodozyma cultures with MVA resulted in an increase in carotenoid production [47]. Likewise, deletion of the squalene synthase-encoding gene (ERG9) in combination with the overexpression of the catalytic domain of HMGR in a recombinant C. utilis strain that produces carotenoids caused an increase of in lycopene biosynthesis [48].

IPP is the isoprenoid building block; in most eukar-yotes, it is derived from the MVA pathway [10]. Many of the regulatory aspects of isoprenoid biosynthesis involve elements of this pathway; the expression of HMGR (Figure 1) is a critical regulatory step [49]. The alteration of HMGR expression in the X. dendrorhous cyp61 mutants could explain the increased carotenoid and sterol content. We quantified the HMGR transcript levels, and at all of the growth phases analyzed, it was greater than in the corresponding parental strain. Similarly, an increase in the HMGR transcript level corresponded to an increase in the carotenoid content when the fungus Blaskelea tripora was treated with ketoconazole, which is a specific ergosterol biosynthesis inhibitor [50]. In S. cerevisiae, HMG-CoA reductase is encoded by two isogenes, HMG1 and HMG2, and the expression of HMG1 is controlled at the transcriptional level by ergosterol [26]. The overexpression of HMG1 combined with keto-conazole treatment in a S. cerevisiae recombinant strain resulted in an increase in beta-carotene production [51]. Finally, our results are similar to those reported in the astaxanthin over-producing X. dendrorhous mutant strain with lower ergosterol and a higher HMGR transcript level than the parental strain after 72 h of cultivation [46]. However, the astaxanthin over-producing strain was obtained by random chemical mutagenesis, while we specifically blocked ergosterol biosynthesis by disrupting the CYP61 gene.

Conclusions

In conclusion, the CYP61 gene disruption in X. dendrorhous prevents the synthesis of ergosterol without

affecting the growth of the yeast under the experimental conditions used in this work. The cyp61 mutant strains accumulate ergosta-5,8,22-trien-3-ol and ergosta-5,8-dien-3-ol that may fulfill some of the ergosterol roles in the cell. In addition, our results strongly suggest that by a feedback regulatory mechanism, ergosterol regulates the synthesis of sterols and carotenoids in the astaxanthin-producing yeast X. dendrorhous, being the HMGR gene expression, one of its targets.

Methods

Microorganisms, plasmids, media, and enzymes

The strains and plasmids that were used or created in this work are listed in Table 2. The wild-type UCD 67385 X. dendrorhous strain was used for cDNA library construction and genomic CYP61 gene amplification. E. coli DH-5a was used as a host for plasmid propagation.

X. dendrorhous strains were grown at 22°C with constant agitation in YM medium (1% glucose, 0.3% yeast extract, 0.3% malt extract and 0.5% peptone). Yeast transformant selection was performed on 1.5% agar YM-plates supplemented with 10 ^g/ml hygromycin B and/ or 15 ^g/ml zeocin. E. coli strains were grown with constant agitation at 37°C in Luria-Bertani (LB) medium supplemented with 100 ^g/ml ampicillin for plasmid selection and 40 of a 2% solution of X-gal (5-bromo-4chloro-3-indolyl-|3-D-galactopyranoside) for recombinant clone selection [52]. Recombinant clones bearing the plasmids with the hygromycin B or zeocin resistance cassettes were selected by direct colony PCR with primers specific for each cassette [21,31]. The zeocin resistance cassette was constructed in the same way as the hygromycin B resistance cassette [31] using the Sh ble gene from Streptoalloteichus hindustanus [53,54]. The Taq DNA polymerase (pol), restriction enzymes, Klenow polymerase and M-MLV reverse transcriptase were purchased from Promega, and the Pfu DNA pol was purchased from Invitrogen.

DNA amplification and sequence analysis

The oligonucleotides designed for this study (Table 1) were purchased from Alpha DNA or from Integrated DNA Technologies. PCR reactions were performed in a DNA thermal cycler 2400 (Perkin-Elmer) in a final volume of 25 containing 2 U of Taq DNA pol, 2.5 of 10X Taq buffer, 0.5 ц1 of 10 mM dNTPs, 1 ц1 of 50 mM MgCl2, 1 ц1 of each primer (25 ^M) and 10 to 20 ng of template DNA. In general, the amplification protocol was as follows: initial denaturation at 95°C for 3 min; 35 cycles of denaturation at 94°C for 30 s, annealing at 55°C for 30 s, and synthesis at 72°C for 3 min; and a final extension step at 72°C for 10 min. Samples were kept at 4°C until checked by 0.8% agarose gel electro-phoresis in TAE buffer containing 0.5 ^g/ml ethidium

bromide [52]. DNA for sequencing or plasmid construction was purified from gels with glass milk [55].

Nucleotide sequences were obtained from an ABI 3100 Avant genetic analyzer using the BigDye terminator v3.1 kit (Applied Biosystems). DNA sequences were analyzed with Vector NTI Suite 10 (Informax), CLUSTAL W 1.8 and programs available at the NCBI web site. Protein sequence analyses were performed with programs available at www.ch.embnet.org/software/TMPRED_form.html [56], www.ebi.ac.uk/InterProScan/ [57] and www.cyped. uni-stuttgart.de/ [58].

Cloning of the X. dendrorhous CYP61 gene and plasmid construction

Our group has partially sequenced the genome of the wild-type UCD 67-385 X. dendrorhous strain by two Next Generation Sequencing (NGS) systems. Our collection of scaffolds covers approximately 95% of the haploid genome of the yeast. We used the CLC Genomics Workbench 5 for genome analyses. BLAST analyses allowed us to identify the X. dendrorhous CYP61 gene, and primers were designed from its sequence (Table 1).

The pBS-gCyp61 plasmid (Figure 4) was generated by inserting a 4,224 bp PCR-amplified DNA fragment encoding the CYP61 gene into the EcoRV site of pBluescript SK- plasmid. The DNA fragment was amplified using the primer set CYP61up2.F + CYP61dw2.R (Table 1) and gen-omic DNA of the UCD 67-385 wild-type strain as template. Plasmids pBS-cyp61/Hyg and pBS-cyp61/Zeo were created by cloning the hygromycin B and the zeocin resistance cassettes, respectively, into the EcoRV site of plasmid pBS-cyp61 (Figure 4). Plasmid pBS-cCyp61, bearing the cDNA of the CYP61 gene, was obtained from a X. den-drorhous cDNA library made with the pBluescript II XR cDNA library construction kit (Stratagene) [31].

X. dendrorhous transformation

X. dendrorhous transformation was performed by electro-poration according to [59] and [60]. Electrocompetent cells were prepared from an exponential culture (OD600nm = 1.2), grown in YM medium and electroporated using a BioRad gene pulser x cell with PC and CE modules under the following conditions: 125 mF, 600 П, 0.45 kV. Transformations were performed using 1 to 5 ^g of linear donor DNA prepared by cutting pBS-cyp61/Hyg or pBS-cyp61/ Zeo with XbaI. The transformant strains were identified as X. dendrorhous by analysis of the ITS1, 5.8 rRNA gene and ITS2 DNA sequences [61]. The transformant strains were identified as X. dendrorhous by analysis of the ITS1, 5.8 rRNA gene and ITS2 DNA sequences [61].

Phenotypic analyses of cyp61 mutant strains

To compare the phenotypic differences between wildtype and CYP61 mutant strains, phenotypic analyses were

performed. The strains were grown in YM medium, and growth curves were constructed including the analyses of total carotenoid yield and composition, ergosterol production and relative mRNA expression of the HMGR gene at three timepoints. For these analyses, the seven X. dendror-hous strains (UCD 67-385, 385-cyp61(+/-), 385-cyp61(-/-), CBS 6938, CBS-cyp61(-), AVHN2 and Av2-cyp61(-)) were cultivated in triplicate 600 ml YM cultures in Erlenmeyer flasks at 22°C with constant agitation. The yeast growth was determined by the OD at 600 nm, which was measured in V-630 UV-vis Spectrophotometer from JASCO. Culture samples of 75 ml were taken after 24, 72 and 120 h of growth and segregated for analysis as follows: 5 ml to determine the dry weight of the yeast, 30 ml for RNA, 30 ml for pigment and 10 ml for sterol extractions. In each case, the cell pellet was washed with distilled water, frozen with liquid nitrogen and stored at -80°C until further processing.

Carotenoid extraction and RP-HPLC

Carotenoids were extracted from cellular pellets according to the acetone extraction method [62]. Total caro-tenoids were quantified by absorbance at 465 nm using an absorption coefficient of A1% = 2,100 and normalized to the dry weight of the yeast. Carotenoids were separated by RP-HPLC using a reverse phase RP-18 Lichro-cart125-4 (Merck) column with acetonitrile: methanol: isopropyl (85:10:5 v/v) as the mobile phase with a 1 ml/ min flux under isocratic conditions. The elution spectra were recovered using a diode array detector, and carote-noids were identified by their spectra and retention time according to standards.

Sterol extraction and identification

Sterol extraction was adapted from [63] and [64]. Briefly, 4 g of KOH and 16 ml of 60% (v/v) ethanol/water were added to the cell pellets, which were mixed and saponified at 80 ± 2°C for 2 h. Non-saponificable sterols were extracted with 10 ml of petroleum and dried. Sterols were separated by RP-HPLC with a C-18 column, using methanol/water (97:3, v/v) as the mobile phase at 1 ml/min. The elution spectra were recovered using a diode array detector, and sterols were visualized in the 280 nm channel. Standard ergosterol was purchased at Sigma-Aldrich (catalogue number 57-87-4). Sterols were quantified spec-trophotometrically at 280 nm [65]. The identification of the sterols was performed by an external service (Cor-thorn Quality; http://www.corthorn.cl/) by GC/MS (Agilent 5970N gas chromatographer/Agilent 5890N mass spectrometer). An RTX5 sil MS (Restk) 30 m x 250 ^mx 0.25 ^m column was used with the following oven conditions: 270°C for 10 s, raised to 280°C at 30°C/min and maintained for 2 min. The injector temperature was 270°C, and the ion source was kept at 70 eV. Helium was

used as the mobile phase with a flux rate of 1 ml/min. For sterol identification the NIST Standard Reference Database 1A (NIST/EPA/NIH Mass Spectral Library (NIST 08) and NIST Mass Spectral Search Program version 2.0f, was used (http://www.nist.gov/srd/).

RNA extraction, single strand DNA synthesis and RT-qPCR

Total RNA extraction from the cell pellets was performed via mechanical rupture with 0.5 mm glass beads (BioSpec) and shaking in a vortex apparatus for 10 min followed by the addition of Tri-Reagent (Ambion). The lysate was incubated for 10 min at room temperature, and 150 ^l of chloroform per ml of Tri-Reagent was added. The aqueous phase was recovered after centrifuga-tion for 5 min at 4,000 x g. Two consecutive extractions with acidic phenol:chloroform (1:1) were performed, and the RNA was precipitated by adding two volumes of iso-propanol and incubating at room temperature for 10 min. The RNA was washed with 75% ethanol, suspended in RNase-free H2O and quantified by absorbance determination at 260 nm in V-630 UV-vis Spectrophotometer from JASCO.

The synthesis of cDNA was performed according to the M-MLV reverse transcriptase (Invitrogen) manufacturer's protocol, with 5 ^g of total RNA in a final volume of 20 ^l. The determination of the relative gene expression levels was performed in an Mx3000P quantitative PCR system (Stratagene) using 1 ^l of the reverse transcription reaction, 0.25 ^M of each primer (Table 1) and 10 ^l of the SensiMix SYBR Green I (Quantace) kit in a final volume of 20 ^l. The Ct values obtained were normalized to the respective value of the beta-actin, ACT [Genbank: X89898.1] [66] and later expressed as a function of the control conditions using the AACt algorithm [35].

Additional file

Additional file 1: Figure S1. GC-MS analysis of sterols from wild-type and cyp61 X. dendrorhous mutant strain. GC profiles of sterols (peaks N° 1, 2 and 3) from UCD 67-385 (panelA) and 385-cyp61<-/-> (panelB) strains. Sterols structures were identified according to their retention times and mass spectra (NIST Standard Reference Database). Panels C, D and E show the sample (in red) and Database (in blue) mass spectra: ergosterol(peak N° 1, panelC), ergosta-5,8,22-trien-3-ol(peak N° 2, panelD) and ergosta-5,8-dien-3-ol(peak N° 3, panelE).

Competing interests

The authors declare no competing financialor any non-financialinterests. Authors' contributions

JA conceived the study, participated in its design and coordination. JA carried out the cypô! gene isolation, sequence analysis and X. dendrorhous transformation. IL performed the gene expression, pigment and ergosterol extraction analyses. MSG did the genomic transformants analyses and SB accomplished the growth curves of wild-type and cypôl mutant strains. DS participated in DNA sequencing. PM-M participated in the gene expression analyses. MB contributed in the study design. VC participated in the

experiment design and coordination. JA, MB, VC drafted the manuscript. Allauthors read and approved the finalmanuscript.

Acknowledgements

This work was supported by projects: U. de Chile VID Iniciacion I 10/01-2 to JA and Fondecyt 1100324 to VC. MECESUP-604 by a graduate scholarship to IL.

Received: 3 August 2012 Accepted: 12 October 2012 Published: 18 October 2012

References

1. Golubev WI: Perfect state of Rhodomyces dendrorhous (Phaffia rhodozyma). Yeast 1995, 11:101-110.

2. Johnson EA: Phaffia rhodozyma: colorful Odyssey. Int Microbiol 2003, 6:169-174.

3. Guerin M, Huntley ME, Olaizola M: Haematococcus astaxanthin: applications for human health and nutrition. Trends Biotechnol 2003, 21:210-216.

4. Schroeder WA, Johnson EA: Antioxidant role of carotenoids in Phaffia rhodozyma. J Gen Microbiol 1993, 139:907-912.

5. Schroeder WA, Johnson EA: Singlet oxygen and peroxyl radicals regulate carotenoid biosynthesis in Phaffia rhodozyma. J Biol Chem 1995, 270:18374-18379.

6. Schroeder WA, Johnson EA: Carotenoids protect Phaffia rhodozyma against singlet oxygen damage. J Ind Microbiol Biotechnol 1995,14:502-507.

7. Fassett RG, Coombes JS: Astaxanthin: a potential therapeutic agent in cardiovascular disease. Mar Drugs 2011, 9:447-465.

8. Higuera-Ciapara I, Felix-Valenzuela L, Goycoolea FM: Astaxanthin: a review of its chemistry and applications. Crit Rev Food Sci Nutr 2006,46:185-196.

9. Britton G, Liaaen-Jensen S, Pfander H: Carotenoids handbook. Switzerland: Birkhäuser Verlag; 2004.

10. Miziorko HM: Enzymes of the mevalonate pathway of isoprenoid biosynthesis. Arch Biochem Biophys 2011, 505:131-143.

11. Goldstein JL, Brown MS: Regulation of the mevalonate pathway. Nature 1990, 343:425-430.

12. Merkulov S, van Assema F, Springer J, Fernandez del Carmen A, Mooibroek H: Loning and characterization of the Yarrowia lipolytica squalene synthase (SQS1) gene and functional complementation of theSaccharomyces cerevisiae erg9 mutation. Yeast 2000, 16:197-206.

13. Verdoes JC, Krubasik P, Sandmann G, Van Ooyen AJJ: Isolation and functional characterization of a novel type of carotenoid biosynthetic gene from Xanthophyllomyces dendrorhous. Mol Gen Genet 1999, 262:453-461.

14. Verdoes JC, Misawa N, van Ooyen AJJ: Cloning and characterization of the astaxanthin biosynthetic gene encoding phytoene desaturase of Xanthophyllomyces dendrorhous. Biotechnol Bioeng 1999, 63:750-755.

15. Ojima K, Breitenbach J, Visser H, Setoguchi Y, Tabata K, Hoshino T, van den Berg J, Sandmann G: Cloning of the astaxanthin synthase gene from Xanthophyllomyces dendrorhous (Phaffia rhodozyma) and its assignment as a ß-carotene 3-hydroxylase/4-ketolase. Mol Genet Genomics 2006, 275:148-158.

16. Alvarez V, Rodriguez-Säiz M, de la Fuente JL, Gudina EJ, Godio RP, Martin JF, Barredo JL: The crtS gene of Xanthophyllomyces dendrorhous encodes a novel cytochrome-P450 hydroxylase involved in the conversion of [beta]-carotene into astaxanthin and other Xanthophylls. Fungal Genet Biol 2006, 43:261 -272.

17. Zhang H, Im SC, Waskell L: Cytochrome b5 increases the rate of product formation by cytochrome P450 2B4 and competes with cytochrome P450 reductase for a binding site on cytochrome P450 2B4. J Biol Chem 2007, 282:29766-29776.

18. Degtyarenko KN, Archakov AI: Molecular evolution of P450 superfamily and P450-containing monooxygenase systems. FEBS Lett 1993, 332:1-8.

19. Kimmich N, Das A, Sevrioukova I, Meharenna Y, Sligar SG, Poulos TL: Electron transfer between cytochrome P450cin and its FMN-containing redox partner, cindoxin. J Biol Chem 2007, 282:27006-27011.

20. McLean KJ, Sabri M, Marshall KR, Lawson RJ, Lewis DG, Clift D, Balding PR, Dunford AJ, Warman AJ, McVey JP: Biodiversity of cytochrome P450 redox systems. Biochem Soc Trans 2005, 33:796-801.

21. Alcaino J, Barahona S, Carmona M, Lozano C, Marcoleta A, Niklitschek M, Sepiilveda D, Baeza M, Cifuentes V: Cloning of the cytochrome p450

reductase (crtR) gene and its involvement in the astaxanthin biosynthesis of Xanthophyllomyces dendrorhous. BMC Microbiol 2008,8:169.

22. Masamoto K, Misawa N, Kaneko T, Kikuno R, Toh H: Beta-carotene hydroxylase gene from the cyanobacterium Synechocystis sp. PCC6803. Plant Cell Physiol 1998, 39:560-564.

23. Zhang YQ, Rao R: Beyond ergosterol: linking pH to antifungal mechanisms. Virulence 2010, 1:551-554.

24. Kelly SL, Lamb DC, Baldwin BC, Corran AJ, Kelly DE: Characterization of Saccharomyces cerevisiae CYP61, sterol &22-desaturase, and inhibition by azole antifungal agents. J Biol Chem 1997, 272:9986-9988.

25. Skaggs BA, Alexander JF, Pierson CA, Schweitzer KS, Chun KT, Koegel C, Barbuch R, Bard M: Cloning and characterization of the Saccharomyces cerevisiae C-22 sterol desaturase gene, encoding a second cytochrome P-450 involved in ergosterol biosynthesis. Gene 1996, 169:105-109.

26. Veen M, Lang C: Production of lipid compounds in the yeast Saccharomyces cerevisiae. Appl Environ Microbiol 2004, 63:635-646.

27. Werck-Reichhart D, Feyereisen R: Cytochromes P450: a success story. Genome Biol 2000, 1:3003.1 -3003.9.

28. Sirim D, Wagner F, Lisitsa A, Pleiss J: The cytochrome P450 engineering database: integration of biochemical properties. BMC Biochem 2009,10:27.

29. van den Brink H, van Gorcom RFM, van den Hondel CA, Punt PJ: Cytochrome P450 enzyme systems in fungi. Fungal Genet Biol 1998, 23:1-17.

30. Hermosilla G, Martínez C, Retamales P, León R, Cifuentes V: Genetic determination of ploidy level in Xanthophyllomyces dendrorhous. Antonie Van Leeuwenhoek 2003, 84:279-287.

31. Niklitschek M, Alcaíno J, Barahona S, Sepúlveda D, Lozano C, Carmona M, Marcoleta A, Martínez C, Lodato P, Baeza M: Genomic organization of the structural genes controlling the astaxanthin biosynthesis pathway of Xanthophyllomyces dendrorhous. Biol Res 2008, 41:93-108.

32. Chang YC, Bien CM, Lee H, Espenshade PJ, Kwong-Chung KJ: Sre1p, A regulator of oxygen sensing and sterol homeostasis, is required for virulence in Cryptococcus neoformans. Molec Microbiol 2007, 64:614-629.

33. Hughes AL, Todd BL, Espenshade PJ: SREBP pathway responds to sterols and functions as an oxygen sensor in fission yeast. Cell 2005, 120:831-842.

34. Pearson WR, Wood T, Zhang Z, Miller W: Comparison of DNA sequences with protein sequences. Genomics 1997,46:24-36.

35. Livak KJ, Schmittgen TD: Analysis of relative gene expression data using real-time quantitative PCR and the 2-[Delta][Delta] CT method. Methods 2001, 25:402-408.

36. Cresnar B, Petric S: Cytochrome P450 enzymes in the fungal kingdom.

Biochim Biophys Acta 2011, 1814:29-35.

37. Lamb DC, Maspahy S, Kelly DE, Manning NJ, Geber A, Bennett JE, Kelly SL: Purification, reconstitution, and inhibition of cytochrome P-450 sterol &22-desaturase from the pathogenic fungus Candida glabrata. Antimicrob Agents Chemother 1999, 43:1725-1728.

38. Kristan K, Rizner TL: Steroid-transforming enzymes in fungi. J Steroid Biochem Mol Biol 2012,129:79-91.

39. Nes WD, Zhou W, Ganapathy K, Liu JL, Vatsyayan R, Chamala S, Hernandez K, Miranda M: Sterol 24-C-methyltransferase: an enzymatic target for the disruption of ergosterol biosynthesis and homeostasis in Cryptococcus neoformans. Arch Biochem Biophys 2009, 481:210-218.

40. Morris DC, Safe S, Subden RE: Detection of the ergosterol and episterol isomers lichesterol and fecosterol in nystatin-resistant mutants of Neurospora crassa. Biochem Genet 1974, 12:459-466.

41. Kanafani ZA, Perfect JR: Antimicrobial resitance: resistance to antifungal agents: mechanisms and clinical impact. Clin Infect Dis 2008, 46:120-128.

42. Shingo H, Yoshihisa ODA, Nishino T, Katsuki H, Aoyama Y, Yoshtoa Y, Nagai J: Characterization of a Saccharomyces cerevisiae mutant, N22, defective in ergosterol synthesis and preparation of [28-14C] ergosta-5, 7-dien-3ß-ol with the mutant. J Biochem 1983, 94:501-510.

43. Ziogas BN, Sisler HD, Lusby WR: Sterol content and other characteristics of pimaricin-resistant mutants of Aspergillus nidulans. Pestic Biochem Physiol 1983, 20:320-329.

44. Wozniak A, Lozano C, Barahona S, Niklitschek M, Marcoleta A, Alcaíno J, Sepulveda D, Baeza M, Cifuentes V: Differential carotenoid production and gene expression in Xanthophyllomyces dendrorhous grown in a nonfermentable carbon source. FEMS Yeast Res 2011, 11:252-262.

45. Lodato P, Alcaíno J, Barahona S, Niklitschek M, Carmona M, Wozniak A, Baeza M, Jiménez A, Cifuentes V: Expression of the carotenoid

biosynthesis genes in Xanthophyllomyces dendrorhous. Biol Res 2007, 40:73-84.

46. Miao L, Chi S, Tang Y, Su Z, Yin T, Guan G, Li Y: Astaxanthin biosynthesis is enhanced by high carotenogenic gene expression and decrease of fatty acids and ergosterol in a Phaffia rhodozyma mutant strain. FEMS Yeast Res 2011, 11:192-201.

47. Calo P, Miguel T, Velazquez JB, Villa TG: Mevalonic acid increases trans-astaxanthin and carotenoid biosynthesis in Phaffia rhodozyma. Biotechnol Lett 1995, 17:575-578.

48. Shimada H, Kondo K, Fraser PD, Miura Y, Saito T, Misawa N: Increased carotenoid production by the food yeast Candida utilis through metabolic engineering of the isoprenoid pathway. Appl Environ Microbiol 1998, 64:2676-2680.

49. Parks LW, Casey WM: Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 1995, 49:95-116.

50. Tang Q, Li Y, Yuan QP: Effects of an ergosterol synthesis inhibitor on gene transcription of terpenoid biosynthesis in Blakeslea trispora. Curr Microbiol 2008, 57:527-531.

51. Yan G, Wen K, Duan C: Enhancement of ß-carotene production by overexpression of HMG-CoA reductase coupled with addition of ergosterol biosynthesis inhibitors in recombinant Saccharomyces cerevisiae. Curr Microbiol 2012, 64:1-5.

52. Sambrook J, Russell DW: Molecular cloning. A laboratory manual. 3rd edition. Cold Spring Harbor NY: Cold Spring Harbor Laboratory Press; 2001.

53. Drocourt D, Calmels T, Reynes JP, Baron M, Tiraby G: Cassettes of the Streptoalloteichus hindustanus ble gene for transformation of lower and higher eukaryotes to phleomycin resistance. Nucleic Acids Res 1990, 18:4009-4009.

54. Calmels T, Parriche M, Durand H, Tiraby G: High efficiency transformation of Tolypocladium geodes conidiospores to phleomycin resistance. Curr Genet 1991, 20:309-314.

55. Boyle JS, Lew AM: An inexpensive alternative to glassmilk for DNA purification. TIG 1995, 11:8.

56. Hofmann K, Stoffel W: TMbase-A database of membrane spanning protein segments. Biol Chem Hoppe Seyler 1993, 374:166.

57. Zdobnov EM, Apweiler R: InterProScan-an integration platform for the signature-recognition methods in InterPro. Bioinformatics 2001, 17:847-848.

58. Sirim D, Widmann M, Wagner F, Pleiss J: Prediction and analysis of the modular structure of cytochrome P450 monooxygenases. BMC Struct Biol 2010, 10:34.

59. Adrio JL, Veiga M: Transformation of the astaxanthin-producing yeast Phaffia rhodozyma. Biotechnol Tech 1995, 9:509-512.

60. Kim IG, Nam SK, Sohn JH, Rhee SK, An GH, Lee SH, Choi ES: Cloning of the ribosomal protein L41 gene of Phaffia rhodozyma and its use as a drug resistance marker for transformation. Appl Environ Microbiol 1998, 64:1947-1949.

61. Fell JW, Blatt GM: Separation of strains of the yeasts Xanthophyllomyces dendrorhous and Phaffia rhodozyma based on rDNA IGS and ITS sequence analysis. J Ind Microbiol Biotechnol 1999, 23:677-681.

62. An GH, Schuman DB, Johnson EA: Isolation of Phaffia rhodozyma mutants with increased astaxanthin content. Appl Environ Microbiol 1989, 55:116-124.

63. Shang F, Wen S, Wang X, Tan T: Effect of nitrogen limitation on the ergosterol production by fed-batch culture of Saccharomyces cerevisiae. J Biotechnol 2006, 122:285-292.

64. Cheng B, Yuan Q, Sun X, Li W: Enhanced production of coenzyme Q10 by overexpressing HMG-CoA reductase and induction with arachidonic acid in Schizosaccharomyces pombe. Appl Biochem Biotechnol 2010, 160:523531.

65. Lamacka M, Sajbidor J: Ergosterol determination in Saccharomyces cerevisiae comparison of different methods. Biotechnol Tech 1997,1 1:723-725.

66. Wery J, Dalderup MJM, Ter Linde J, Boekhout T, Van Ooyen AJJ: Structural and phylogenetic analysis of the actin gene from the yeast Phaffia rhodozyma. Yeast 1996, 12:641-651.

doi:10.118б/1471-2180-12-235

Cite this article as: Loto et al.: Enhancement of carotenoid production by disrupting the C22-sterol desaturase gene (CYP61) in Xanthophyllomyces dendrorhous. BMC Microbiology 2012 12:235.

Submit your next manuscript to BioMed Central and take full advantage of:

• Convenient online submission

• Thorough peer review

• No space constraints or color figure charges

• Immediate publication on acceptance

• Inclusion in PubMed, CAS, Scopus and Google Scholar

• Research which is freely available for redistribution

Submit your manuscript at Tpntral

www.biomedcentral.com/submit >_ciiuai